Products

cDNA Clones (22)
Proteins (10)
Antibodies (3)
Jump to Filters
View as table Download
hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone
RC201627

USD 420.00

In Stock

HNRNPU (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
hnRNP U (HNRNPU) (NM_004501) Human Recombinant Protein
TP301627

USD 823.00

In Stock

Recombinant protein of human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone Lentiviral Particle
RC201627L1V

USD 820.00

3 Weeks

Lenti ORF particles, HNRNPU (Myc-DDK tagged) - Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone Lentiviral Particle
RC201627L2V

USD 820.00

6 Weeks

Lenti ORF particles, HNRNPU (mGFP-tagged) - Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
hnRNP U (HNRNPU) (NM_031844) Human Tagged ORF Clone Lentiviral Particle
RC214320L1V

USD 1,010.00

3 Weeks

Lenti ORF particles, HNRNPU (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
hnRNP U (HNRNPU) (NM_031844) Human Tagged ORF Clone Lentiviral Particle
RC214320L2V

USD 1,010.00

6 Weeks

Lenti ORF particles, HNRNPU (mGFP-tagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
hnRNP U (HNRNPU) (NM_031844) Human Tagged ORF Clone
RC214320

USD 610.00

In Stock

HNRNPU (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone
RG201627

USD 460.00

In Stock

HNRNPU (GFP-tagged) - Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone
RC201627L3

USD 620.00

3 Weeks

Lenti ORF clone of Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone Lentiviral Particle
RC201627L3V

USD 820.00

5 Weeks

Lenti ORF particles, HNRNPU (Myc-DDK tagged) - Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone
RC201627L4

USD 620.00

3 Weeks

Lenti ORF clone of Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone Lentiviral Particle
RC201627L4V

USD 820.00

7 Weeks

Lenti ORF particles, HNRNPU (mGFP-tagged) - Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
hnRNP U (HNRNPU) (NM_031844) Human Tagged ORF Clone
RC214320L3

USD 810.00

3 Weeks

Lenti-ORF clone of HNRNPU (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
hnRNP U (HNRNPU) (NM_031844) Human Tagged ORF Clone Lentiviral Particle
RC214320L3V

USD 1,010.00

7 Weeks

Lenti ORF particles, HNRNPU (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
hnRNP U (HNRNPU) (NM_031844) Human Tagged ORF Clone
RC214320L4

USD 810.00

3 Weeks

Lenti-ORF clone of HNRNPU (mGFP-tagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
hnRNP U (HNRNPU) (NM_031844) Human Tagged ORF Clone Lentiviral Particle
RC214320L4V

USD 1,010.00

7 Weeks

Lenti ORF particles, HNRNPU (mGFP-tagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
hnRNP U (HNRNPU) (NM_031844) Human Tagged ORF Clone
RG214320

USD 670.00

3 Weeks

HNRNPU (GFP-tagged) - Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
hnRNP U (HNRNPU) Rabbit Polyclonal Antibody
TA345875

USD 475.00

In Stock

Rabbit Polyclonal Anti-HNRNPU Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRNPU antibody: synthetic peptide directed towards the C terminal of human HNRNPU. Synthetic peptide located within the following region: EITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQF
hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone
RC201627L1

USD 768.00

In Stock

Lenti ORF clone of Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
hnRNP U (HNRNPU) (NM_004501) Human Untagged Clone
SC109317

USD 310.00

In Stock

HNRNPU (untagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
hnRNP U (HNRNPU) Rabbit Polyclonal Antibody
TA345876

USD 475.00

5 Days

Rabbit Polyclonal Anti-HNRNPU Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRNPU antibody: synthetic peptide directed towards the N terminal of human HNRNPU. Synthetic peptide located within the following region: NGAAGAADSGPMEEEEAASEDENGDDQGFQEGEDELGDEEEGAGDENGHG
hnRNP U (HNRNPU) (NM_004501) Human Over-expression Lysate
LY401431

USD 396.00

5 Days

Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone
RC201627L2

USD 620.00

3 Weeks

Lenti ORF clone of Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
hnRNP U (HNRNPU) (NM_031844) Human Tagged ORF Clone
RC214320L2

USD 810.00

3 Weeks

Lenti-ORF clone of HNRNPU (mGFP-tagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
hnRNP U (HNRNPU) (NM_031844) Human Untagged Clone
SC107014

USD 1,670.00

In Stock

HNRNPU (untagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
hnRNP U (HNRNPU) (NM_004501) Human Untagged Clone
SC323776

USD 310.00

In Stock

HNRNPU (untagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
hnRNP U (HNRNPU) Mouse Monoclonal Antibody [Clone ID: 1B11-H2-B7]
TA346966

USD 380.00

4 Weeks

Mouse Monoclonal hnRNP U Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
hnRNP U (HNRNPU) (NM_004501) Human Over-expression Lysate
LC401431

USD 121.00

2 Weeks

HNRNPU HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
hnRNP U (HNRNPU) (NM_004501) Human Mass Spec Standard
PH301627

USD 2,055.00

3 Weeks

HNRNPU MS Standard C13 and N15-labeled recombinant protein (NP_004492)

Tag C-Myc/DDK
Expression Host HEK293
hnRNP U (HNRNPU) ICC Control Block
TB401627

USD 1,070.00

4 Weeks

Transient overexpression of HNRNPU (NM_004501) in HEK293T cells paraffin embedded controls for ICC/IHC staining

hnRNP U (HNRNPU) ICC Control Block
TB414320

USD 1,260.00

4 Weeks

Transient overexpression of HNRNPU (NM_031844) in HEK293T cells paraffin embedded controls for ICC/IHC staining

hnRNP U (HNRNPU) Cytosection
TS401627

USD 225.00

4 Weeks

Transient overexpression of HNRNPU (NM_004501) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

hnRNP U (HNRNPU) Cytosection
TS401627P5

USD 889.00

4 Weeks

Transient overexpression of HNRNPU (NM_004501) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

hnRNP U (HNRNPU) Cytosection
TS414320

USD 225.00

4 Weeks

Transient overexpression of HNRNPU (NM_031844) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

hnRNP U (HNRNPU) Cytosection
TS414320P5

USD 889.00

4 Weeks

Transient overexpression of HNRNPU (NM_031844) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack