Products

cDNA Clones (35)
RNAi (13)
Proteins (11)
Gene Expression (7)
Antibodies (6)
Jump to Filters
View as table Download
hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone
RC201627

USD 420.00

In Stock

HNRNPU (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
hnRNP U (HNRNPU) (NM_004501) Human Recombinant Protein
TP301627

USD 823.00

In Stock

Recombinant protein of human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Hnrnpu (NM_016805) Mouse Tagged ORF Clone
MR210713

USD 840.00

In Stock

Hnrnpu (Myc-DDK-tagged) - Mouse heterogeneous nuclear ribonucleoprotein U (Hnrnpu)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone Lentiviral Particle
RC201627L1V

USD 820.00

3 Weeks

Lenti ORF particles, HNRNPU (Myc-DDK tagged) - Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone Lentiviral Particle
RC201627L2V

USD 820.00

6 Weeks

Lenti ORF particles, HNRNPU (mGFP-tagged) - Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
hnRNP U (HNRNPU) (NM_031844) Human Tagged ORF Clone Lentiviral Particle
RC214320L1V

USD 1,010.00

3 Weeks

Lenti ORF particles, HNRNPU (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
hnRNP U (HNRNPU) (NM_031844) Human Tagged ORF Clone Lentiviral Particle
RC214320L2V

USD 1,010.00

6 Weeks

Lenti ORF particles, HNRNPU (mGFP-tagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
hnRNP U (HNRNPU) (NM_031844) Human Tagged ORF Clone
RC214320

USD 610.00

In Stock

HNRNPU (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone
RG201627

USD 460.00

In Stock

HNRNPU (GFP-tagged) - Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Hnrnpu Mouse Gene Knockout Kit (CRISPR)
KN507863

USD 1,290.00

2 Weeks

Hnrnpu - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN507863 is the updated version of KN307863.
Hnrnpu (NM_016805) Mouse Tagged ORF Clone
MG210713

USD 920.00

3 Weeks

Hnrnpu (GFP-tagged) - Mouse heterogeneous nuclear ribonucleoprotein U (Hnrpu)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Hnrnpu (NM_016805) Mouse Tagged ORF Clone
MR210713L3

USD 1,040.00

3 Weeks

Lenti ORF clone of Hnrnpu (Myc-DDK-tagged) - Mouse heterogeneous nuclear ribonucleoprotein U (Hnrnpu)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Hnrnpu (NM_016805) Mouse Tagged ORF Clone Lentiviral Particle
MR210713L3V

USD 1,240.00

6 Weeks

Lenti ORF particles, Hnrnpu (Myc-DDK-tagged) - Mouse heterogeneous nuclear ribonucleoprotein U (Hnrnpu), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Hnrnpu (NM_016805) Mouse Tagged ORF Clone Lentiviral Particle
MR210713L4V

USD 1,240.00

6 Weeks

Lenti ORF particles, Hnrnpu (GFP-tagged) - Mouse heterogeneous nuclear ribonucleoprotein U (Hnrnpu), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone
RC201627L3

USD 620.00

3 Weeks

Lenti ORF clone of Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone Lentiviral Particle
RC201627L3V

USD 820.00

5 Weeks

Lenti ORF particles, HNRNPU (Myc-DDK tagged) - Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone
RC201627L4

USD 620.00

3 Weeks

Lenti ORF clone of Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone Lentiviral Particle
RC201627L4V

USD 820.00

7 Weeks

Lenti ORF particles, HNRNPU (mGFP-tagged) - Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
hnRNP U (HNRNPU) (NM_031844) Human Tagged ORF Clone
RC214320L3

USD 810.00

3 Weeks

Lenti-ORF clone of HNRNPU (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
hnRNP U (HNRNPU) (NM_031844) Human Tagged ORF Clone Lentiviral Particle
RC214320L3V

USD 1,010.00

7 Weeks

Lenti ORF particles, HNRNPU (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
hnRNP U (HNRNPU) (NM_031844) Human Tagged ORF Clone
RC214320L4

USD 810.00

3 Weeks

Lenti-ORF clone of HNRNPU (mGFP-tagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
hnRNP U (HNRNPU) (NM_031844) Human Tagged ORF Clone Lentiviral Particle
RC214320L4V

USD 1,010.00

7 Weeks

Lenti ORF particles, HNRNPU (mGFP-tagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
hnRNP U (HNRNPU) (NM_031844) Human Tagged ORF Clone
RG214320

USD 670.00

3 Weeks

HNRNPU (GFP-tagged) - Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Hnrnpu (NM_057139) Rat Tagged ORF Clone
RR209966

USD 1,080.00

5 Weeks

Hnrnpu (Myc-DDK-tagged ORF) - Rat heterogeneous nuclear ribonucleoprotein U (Hnrnpu), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Hnrnpu (NM_057139) Rat Tagged ORF Clone
RR209966L3

USD 1,270.00

12 Weeks

Lenti ORF clone of Hnrnpu (Myc-DDK-tagged ORF) - Rat heterogeneous nuclear ribonucleoprotein U (Hnrnpu), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Hnrnpu (NM_057139) Rat Tagged ORF Clone Lentiviral Particle
RR209966L3V

USD 1,480.00

16 Weeks

Lenti ORF particles, Hnrnpu (Myc-DDK-tagged ORF) - Rat heterogeneous nuclear ribonucleoprotein U (Hnrnpu), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Hnrnpu (NM_057139) Rat Tagged ORF Clone
RR209966L4

USD 1,390.00

12 Weeks

Lenti ORF clone of Hnrnpu (mGFP-tagged ORF) - Rat heterogeneous nuclear ribonucleoprotein U (Hnrnpu), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Hnrnpu (NM_057139) Rat Tagged ORF Clone Lentiviral Particle
RR209966L4V

USD 1,650.00

16 Weeks

Lenti ORF particles, Hnrnpu (GFP-tagged ORF) - Rat heterogeneous nuclear ribonucleoprotein U (Hnrnpu), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
hnRNP U (HNRNPU) Rabbit Polyclonal Antibody
TA345875

USD 475.00

In Stock

Rabbit Polyclonal Anti-HNRNPU Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRNPU antibody: synthetic peptide directed towards the C terminal of human HNRNPU. Synthetic peptide located within the following region: EITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQF
hnRNP U (HNRNPU) Rabbit Polyclonal Antibody
TA371595

USD 380.00

4 Weeks

HNRNPU rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HNRNPU
Hnrnpu (NM_016805) Mouse Untagged Clone
MC200653

USD 210.00

In Stock

Hnrnpu (untagged) - Mouse heterogeneous nuclear ribonucleoprotein U (Hnrnpu), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
Hnrnpu (NM_016805) Mouse Tagged ORF Clone
MR210713L4

USD 1,284.00

In Stock

Lenti ORF clone of Hnrnpu (mGFP-tagged) - Mouse heterogeneous nuclear ribonucleoprotein U (Hnrnpu)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone
RC201627L1

USD 768.00

In Stock

Lenti ORF clone of Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
hnRNP U (HNRNPU) (NM_004501) Human Untagged Clone
SC109317

USD 310.00

In Stock

HNRNPU (untagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
HNRNPU Human siRNA Oligo Duplex (Locus ID 3192)
SR302175

USD 430.00

In Stock

HNRNPU (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

hnRNP U (HNRNPU) Rabbit Polyclonal Antibody
TA345876

USD 475.00

5 Days

Rabbit Polyclonal Anti-HNRNPU Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRNPU antibody: synthetic peptide directed towards the N terminal of human HNRNPU. Synthetic peptide located within the following region: NGAAGAADSGPMEEEEAASEDENGDDQGFQEGEDELGDEEEGAGDENGHG
hnRNP U (HNRNPU) (NM_004501) Human Over-expression Lysate
LY401431

USD 396.00

5 Days

Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

hnRNP U (HNRNPU) (NM_004501) Human Tagged ORF Clone
RC201627L2

USD 620.00

3 Weeks

Lenti ORF clone of Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
hnRNP U (HNRNPU) (NM_031844) Human Tagged ORF Clone
RC214320L2

USD 810.00

3 Weeks

Lenti-ORF clone of HNRNPU (mGFP-tagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
hnRNP U (HNRNPU) (NM_031844) Human Untagged Clone
SC107014

USD 1,670.00

In Stock

HNRNPU (untagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
hnRNP U (HNRNPU) (NM_004501) Human Untagged Clone
SC323776

USD 310.00

In Stock

HNRNPU (untagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Hnrnpu Rat siRNA Oligo Duplex (Locus ID 117280)
SR509679

USD 430.00

In Stock

Hnrnpu (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Hnrnpu Mouse siRNA Oligo Duplex (Locus ID 51810)
SR420257

USD 430.00

In Stock

Hnrnpu (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).
Hnrnpu Mouse shRNA Plasmid (Locus ID 51810)
TG514929

USD 715.00

2 Weeks

Hnrnpu - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS
Hnrnpu Mouse qPCR Primer Pair (NM_016805)
MP206073

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Hnrnpu

hnRNP U (HNRNPU) Mouse Monoclonal Antibody [Clone ID: 1B11-H2-B7]
TA346966

USD 380.00

4 Weeks

Mouse Monoclonal hnRNP U Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Hnrnpu Rat shRNA Plasmid (Locus ID 117280)
TL712369

USD 815.00

2 Weeks

Hnrnpu - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
Human hnRNP U (HNRNPU) activation kit by CRISPRa
GA102180

USD 1,290.00

2 Weeks

HNRNPU CRISPRa kit - CRISPR gene activation of human heterogeneous nuclear ribonucleoprotein U

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Hnrnpu activation kit by CRISPRa
GA205423

USD 1,290.00

2 Weeks

Hnrnpu CRISPRa kit - CRISPR gene activation of mouse heterogeneous nuclear ribonucleoprotein U

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
hnRNP U (HNRNPU) Human qPCR Template Standard (NM_004501)
HK203758

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene HNRNPU

Application Plasmid of exact quantity for transcript copy number calculation