LSM2 (Myc-DDK-tagged)-Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LSM2 (Myc-DDK-tagged)-Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LSM2 (GFP-tagged) - Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, LSM2 (Myc-DDK tagged) - Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, LSM2 (mGFP-tagged) - Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-LSM2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LSM2 antibody: synthetic peptide directed towards the middle region of human LSM2. Synthetic peptide located within the following region: TDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ |
LSM2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
LSM2 (untagged)-Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Goat Anti-LSM2 (aa33-46) Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DQYLNIKLTDISVT, from the internal region of the protein sequence according to NP_067000.1. |
LSM2 (1-95, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
LSM2 (1-95, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Transient overexpression lysate of LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression of LSM2 (NM_021177) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LSM2 (NM_021177) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LSM2 (NM_021177) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack