Germany
Japan
United Kingdom
China
PPIE (Myc-DDK-tagged)-Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
PPIE (Myc-DDK-tagged)-Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Homo sapiens peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
PPIE (Myc-DDK-tagged)-Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPIE (GFP-tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PPIE (Myc-DDK tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PPIE (mGFP-tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PPIE (Myc-DDK tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PPIE (mGFP-tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PPIE (Myc-DDK tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PPIE (mGFP-tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PPIE (GFP-tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPIE (GFP-tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-PPIE Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPIE antibody: synthetic peptide directed towards the middle region of human PPIE. Synthetic peptide located within the following region: KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP |
Rabbit Polyclonal Anti-PPIE Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPIE antibody: synthetic peptide directed towards the middle region of human PPIE. Synthetic peptide located within the following region: RIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG |
(untagged)-Human cDNA FLJ36340 fis, clone THYMU2006468
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PPIE (untagged)-Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Cyclophilin E (1-301, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Cyclophilin E (1-301, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
PPIE HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PPIE HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transient overexpression lysate of peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
PPIE MS Standard C13 and N15-labeled recombinant protein (NP_006103)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PPIE (untagged)-Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of PPIE (NM_203456) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPIE (NM_006112) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPIE (NM_001195007) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1
| Tag | N-His |
| Expression Host | E. coli |
Recombinant protein of human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1
| Tag | N-His |
| Expression Host | E. coli |
Recombinant protein of human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1
| Tag | N-His |
| Expression Host | E. coli |
Recombinant protein of human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1
| Tag | N-His |
| Expression Host | E. coli |
Transient overexpression of PPIE (NM_203456) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PPIE (NM_203456) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PPIE (NM_006112) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PPIE (NM_006112) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PPIE (NM_001195007) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PPIE (NM_001195007) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PPIE
Pathways
- Spliceosome