Products

View as table Download

PPIE (Myc-DDK-tagged)-Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Purified recombinant protein of Homo sapiens peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T

PPIE (Myc-DDK-tagged)-Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PPIE (GFP-tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPIE (Myc-DDK tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPIE (mGFP-tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPIE (Myc-DDK tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPIE (mGFP-tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPIE (Myc-DDK tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPIE (mGFP-tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PPIE (GFP-tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PPIE (GFP-tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-PPIE Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPIE antibody: synthetic peptide directed towards the middle region of human PPIE. Synthetic peptide located within the following region: KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP

Rabbit Polyclonal Anti-PPIE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPIE antibody: synthetic peptide directed towards the middle region of human PPIE. Synthetic peptide located within the following region: RIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG

(untagged)-Human cDNA FLJ36340 fis, clone THYMU2006468

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

PPIE (untagged)-Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Cyclophilin E (1-301, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

Cyclophilin E (1-301, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

PPIE HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PPIE HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

PPIE MS Standard C13 and N15-labeled recombinant protein (NP_006103)

Tag C-Myc/DDK
Expression Host HEK293

PPIE (untagged)-Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression of PPIE (NM_203456) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of PPIE (NM_006112) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of PPIE (NM_001195007) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Recombinant protein of human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1

Tag N-His
Expression Host E. coli

Recombinant protein of human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1

Tag N-His
Expression Host E. coli

Recombinant protein of human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1

Tag N-His
Expression Host E. coli

Recombinant protein of human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1

Tag N-His
Expression Host E. coli

Transient overexpression of PPIE (NM_203456) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of PPIE (NM_203456) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of PPIE (NM_006112) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of PPIE (NM_006112) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of PPIE (NM_001195007) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of PPIE (NM_001195007) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack