Products

cDNA Clones (37)
Proteins (22)
RNAi (11)
Gene Expression (8)
Antibodies (3)
Jump to Filters
View as table Download
Cyclophilin E (PPIE) (NM_006112) Human Tagged ORF Clone
RC214435

USD 420.00

In Stock

PPIE (Myc-DDK-tagged)-Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Cyclophilin E (PPIE) (NM_203457) Human Recombinant Protein
TP303313

USD 823.00

In Stock

Purified recombinant protein of Homo sapiens peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Ppie (NM_019489) Mouse Tagged ORF Clone
MR216659

USD 68.00

USD 149.00

In Stock

Ppie (Myc-DDK-tagged) - Mouse peptidylprolyl isomerase E (cyclophilin E) (Ppie)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Cyclophilin E (PPIE) (NM_203456) Human Tagged ORF Clone
RC212849

USD 420.00

In Stock

PPIE (Myc-DDK-tagged)-Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Cyclophilin E (PPIE) (NM_006112) Human Tagged ORF Clone
RG214435

USD 460.00

In Stock

PPIE (GFP-tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cyclophilin E (PPIE) Human Gene Knockout Kit (CRISPR)
KN403313

USD 1,290.00

2 Weeks

PPIE - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN403313 is the updated version of KN203313.
Ppie Mouse Gene Knockout Kit (CRISPR)
KN513696

USD 1,290.00

2 Weeks

Ppie - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN513696 is the updated version of KN313696.
Ppie (NM_019489) Mouse Tagged ORF Clone
MG216659

USD 300.00

3 Weeks

Ppie (GFP-tagged) - Mouse peptidylprolyl isomerase E (cyclophilin E) (Ppie), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ppie (NM_019489) Mouse Tagged ORF Clone
MR216659L3

USD 500.00

3 Weeks

Lenti ORF clone of Ppie (Myc-DDK-tagged) - Mouse peptidylprolyl isomerase E (cyclophilin E) (Ppie)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ppie (NM_019489) Mouse Tagged ORF Clone Lentiviral Particle
MR216659L3V

USD 700.00

6 Weeks

Lenti ORF particles, Ppie (Myc-DDK-tagged) - Mouse peptidylprolyl isomerase E (cyclophilin E) (Ppie), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ppie (NM_019489) Mouse Tagged ORF Clone
MR216659L4

USD 500.00

3 Weeks

Lenti ORF clone of Ppie (mGFP-tagged) - Mouse peptidylprolyl isomerase E (cyclophilin E) (Ppie)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ppie (NM_019489) Mouse Tagged ORF Clone Lentiviral Particle
MR216659L4V

USD 700.00

6 Weeks

Lenti ORF particles, Ppie (GFP-tagged) - Mouse peptidylprolyl isomerase E (cyclophilin E) (Ppie), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cyclophilin E (PPIE) (NM_203456) Human Tagged ORF Clone
RC212849L3

USD 620.00

3 Weeks

Lenti ORF clone of Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cyclophilin E (PPIE) (NM_203456) Human Tagged ORF Clone Lentiviral Particle
RC212849L3V

USD 820.00

6 Weeks

Lenti ORF particles, PPIE (Myc-DDK tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cyclophilin E (PPIE) (NM_203456) Human Tagged ORF Clone
RC212849L4

USD 620.00

3 Weeks

Lenti ORF clone of Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cyclophilin E (PPIE) (NM_203456) Human Tagged ORF Clone Lentiviral Particle
RC212849L4V

USD 820.00

6 Weeks

Lenti ORF particles, PPIE (mGFP-tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cyclophilin E (PPIE) (NM_006112) Human Tagged ORF Clone
RC214435L3

USD 620.00

3 Weeks

Lenti ORF clone of Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cyclophilin E (PPIE) (NM_006112) Human Tagged ORF Clone Lentiviral Particle
RC214435L3V

USD 820.00

6 Weeks

Lenti ORF particles, PPIE (Myc-DDK tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cyclophilin E (PPIE) (NM_006112) Human Tagged ORF Clone
RC214435L4

USD 620.00

3 Weeks

Lenti ORF clone of Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cyclophilin E (PPIE) (NM_006112) Human Tagged ORF Clone Lentiviral Particle
RC214435L4V

USD 820.00

6 Weeks

Lenti ORF particles, PPIE (mGFP-tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cyclophilin E (PPIE) (NM_001195007) Human Tagged ORF Clone
RC231157L3

USD 620.00

3 Weeks

Lenti ORF clone of Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cyclophilin E (PPIE) (NM_001195007) Human Tagged ORF Clone Lentiviral Particle
RC231157L3V

USD 820.00

6 Weeks

Lenti ORF particles, PPIE (Myc-DDK tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cyclophilin E (PPIE) (NM_001195007) Human Tagged ORF Clone
RC231157L4

USD 620.00

3 Weeks

Lenti ORF clone of Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cyclophilin E (PPIE) (NM_001195007) Human Tagged ORF Clone Lentiviral Particle
RC231157L4V

USD 820.00

6 Weeks

Lenti ORF particles, PPIE (mGFP-tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cyclophilin E (PPIE) (NM_203456) Human Tagged ORF Clone
RG212849

USD 460.00

3 Weeks

PPIE (GFP-tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cyclophilin E (PPIE) (NM_001195007) Human Tagged ORF Clone
RG231157

USD 460.00

3 Weeks

PPIE (GFP-tagged) - Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ppie (NM_001047868) Rat Tagged ORF Clone
RR205844

USD 420.00

4 Weeks

Ppie (Myc-DDK-tagged ORF) - Rat peptidylprolyl isomerase E (cyclophilin E) (Ppie), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Ppie (NM_001047868) Rat Tagged ORF Clone
RR205844L3

USD 640.00

8 Weeks

Lenti ORF clone of Ppie (Myc-DDK-tagged ORF) - Rat peptidylprolyl isomerase E (cyclophilin E) (Ppie), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ppie (NM_001047868) Rat Tagged ORF Clone Lentiviral Particle
RR205844L3V

USD 850.00

12 Weeks

Lenti ORF particles, Ppie (Myc-DDK-tagged ORF) - Rat peptidylprolyl isomerase E (cyclophilin E) (Ppie), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ppie (NM_001047868) Rat Tagged ORF Clone
RR205844L4

USD 700.00

8 Weeks

Lenti ORF clone of Ppie (mGFP-tagged ORF) - Rat peptidylprolyl isomerase E (cyclophilin E) (Ppie), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ppie (NM_001047868) Rat Tagged ORF Clone Lentiviral Particle
RR205844L4V

USD 960.00

12 Weeks

Lenti ORF particles, Ppie (GFP-tagged ORF) - Rat peptidylprolyl isomerase E (cyclophilin E) (Ppie), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cyclophilin E (PPIE) Rabbit Polyclonal Antibody
TA345947

USD 410.00

5 Days

Rabbit Polyclonal Anti-PPIE Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPIE antibody: synthetic peptide directed towards the middle region of human PPIE. Synthetic peptide located within the following region: KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP
Cyclophilin E (PPIE) Rabbit Polyclonal Antibody
TA345946

USD 410.00

5 Days

Rabbit Polyclonal Anti-PPIE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPIE antibody: synthetic peptide directed towards the middle region of human PPIE. Synthetic peptide located within the following region: RIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG
Ppie (NM_019489) Mouse Untagged Clone
MC210012

USD 420.00

In Stock

Ppie (untagged) - Mouse peptidylprolyl isomerase E (cyclophilin E) (Ppie), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Cyclophilin E (PPIE) (AK093659) Human Untagged Clone
SC102738

USD 660.00

In Stock

(untagged)-Human cDNA FLJ36340 fis, clone THYMU2006468

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Cyclophilin E (PPIE) (NM_006112) Human Untagged Clone
SC111950

USD 660.00

In Stock

PPIE (untagged)-Human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Cyclophilin E (1-301, His-tag) Human Protein
AR09069PU-L

USD 1,105.00

2 Weeks

Cyclophilin E (1-301, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Cyclophilin E (1-301, His-tag) Human Protein
AR09069PU-N

USD 415.00

2 Weeks

Cyclophilin E (1-301, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Human Cyclophilin E (PPIE) activation kit by CRISPRa
GA107127

USD 1,290.00

2 Weeks

PPIE CRISPRa kit - CRISPR gene activation of human peptidylprolyl isomerase E

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Ppie activation kit by CRISPRa
GA205812

USD 1,290.00

2 Weeks

Ppie CRISPRa kit - CRISPR gene activation of mouse peptidylprolyl isomerase E (cyclophilin E)

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
PPIE Human qPCR Template Standard (NM_006112)
HK209813

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene PPIE

Application Plasmid of exact quantity for transcript copy number calculation
PPIE Human qPCR Template Standard (NM_203457)
HK212597

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene PPIE

Application Plasmid of exact quantity for transcript copy number calculation
Cyclophilin E (PPIE) Human qPCR Primer Pair (NM_006112)
HP209117

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene PPIE

Cyclophilin E (PPIE) (NM_006112) Human Over-expression Lysate
LC416859

USD 121.00

2 Weeks

PPIE HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Cyclophilin E (PPIE) (NM_001195007) Human Over-expression Lysate
LC434156

USD 121.00

2 Weeks

PPIE HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Cyclophilin E (PPIE) (NM_001195007) Human Over-expression Lysate
LY434156

USD 396.00

5 Days

Transient overexpression lysate of peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Ppie Mouse qPCR Primer Pair (NM_019489)
MP210702

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Ppie

Cyclophilin E (PPIE) (NM_006112) Human Mass Spec Standard
PH314435

USD 2,055.00

3 Weeks

PPIE MS Standard C13 and N15-labeled recombinant protein (NP_006103)

Tag C-Myc/DDK
Expression Host HEK293