PUF60 (Myc-DDK-tagged)-Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PUF60 (Myc-DDK-tagged)-Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PUF60 (Myc-DDK-tagged)-Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human poly-U binding splicing factor 60KDa (PUF60), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
PUF60 (GFP-tagged) - Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PUF60 (Myc-DDK tagged) - Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PUF60 (mGFP-tagged) - Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PUF60 (Myc-DDK tagged) - Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PUF60 (mGFP-tagged) - Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PUF60 (Myc-DDK-tagged)-Human poly-U binding splicing factor 60KDa (PUF60), transcript variant c
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of PUF60 (Myc-DDK-tagged)-Human poly-U binding splicing factor 60KDa (PUF60), transcript variant c
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PUF60 (Myc-DDK-tagged)-Human poly-U binding splicing factor 60KDa (PUF60), transcript variant c, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PUF60 (mGFP-tagged)-Human poly-U binding splicing factor 60KDa (PUF60), transcript variant c
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PUF60 (mGFP-tagged)-Human poly-U binding splicing factor 60KDa (PUF60), transcript variant c, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PUF60 (Myc-DDK tagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 8
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PUF60 (Myc-DDK tagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PUF60 (Myc-DDK tagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 7
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PUF60 (Myc-DDK tagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PUF60 (Myc-DDK tagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PUF60 (GFP-tagged) - Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PUF60 (GFP-tagged) - Human poly-U binding splicing factor 60KDa (PUF60), transcript variant c
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PUF60 (GFP-tagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 8
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PUF60 (GFP-tagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PUF60 (GFP-tagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 7
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PUF60 (GFP-tagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PUF60 (GFP-tagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 6
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-PUF60 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PUF60 antibody: synthetic peptide directed towards the C terminal of human PUF60. Synthetic peptide located within the following region: EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA |
Rabbit Polyclonal Anti-PUF60 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PUF60 antibody: synthetic peptide directed towards the C terminal of human PUF60. Synthetic peptide located within the following region: EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA |
Rabbit Polyclonal Anti-PUF60 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PUF60 antibody: synthetic peptide directed towards the C terminal of human PUF60. Synthetic peptide located within the following region: PPIPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQ |
PUF60 (untagged)-Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal antibody to PUF60 (poly-U binding splicing factor 60KDa)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 346 and 523 of PUF60 (Uniprot ID#Q9UHX1) |
PUF60 (untagged)-Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 2
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Goat Polyclonal Antibody against SIAHBP1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-YDQERFDNSDLSA, from the C Terminus of the protein sequence according to NP_510965.1; NP_055096.2. |
PUF60 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PUF60 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of poly-U binding splicing factor 60KDa (PUF60), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of poly-U binding splicing factor 60KDa (PUF60), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PUF60 MS Standard C13 and N15-labeled recombinant protein (NP_055096)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
PUF60 MS Standard C13 and N15-labeled recombinant protein (NP_510965)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
PUF60 (untagged)-Human fuse-binding protein-interacting repressor, mRNA (cDNA clone MGC:9958 IMAGE:3877563), complete cds
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PUF60 (untagged)-Human fuse-binding protein-interacting repressor, mRNA (cDNA clone MGC:18191 IMAGE:4155549), complete cds
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PUF60 (untagged)-Human poly-U binding splicing factor 60KDa (PUF60), transcript variant c
Vector | pCMV6 series |
Tag | Tag Free |
PUF60 (untagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
PUF60 (untagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 5
Vector | pCMV6 series |
Tag | Tag Free |
PUF60 (untagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 6
Vector | pCMV6 series |
Tag | Tag Free |
PUF60 (untagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 7
Vector | pCMV6 series |
Tag | Tag Free |
PUF60 (untagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 8
Vector | pCMV6 series |
Tag | Tag Free |