Products

View as table Download

PUF60 (Myc-DDK-tagged)-Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

PUF60 (Myc-DDK-tagged)-Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

PUF60 (GFP-tagged) - Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PUF60 (Myc-DDK tagged) - Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PUF60 (mGFP-tagged) - Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PUF60 (Myc-DDK tagged) - Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PUF60 (mGFP-tagged) - Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PUF60 (Myc-DDK-tagged)-Human poly-U binding splicing factor 60KDa (PUF60), transcript variant c

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of PUF60 (Myc-DDK-tagged)-Human poly-U binding splicing factor 60KDa (PUF60), transcript variant c

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PUF60 (Myc-DDK-tagged)-Human poly-U binding splicing factor 60KDa (PUF60), transcript variant c, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PUF60 (mGFP-tagged)-Human poly-U binding splicing factor 60KDa (PUF60), transcript variant c

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PUF60 (mGFP-tagged)-Human poly-U binding splicing factor 60KDa (PUF60), transcript variant c, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PUF60 (Myc-DDK tagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 8

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PUF60 (Myc-DDK tagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PUF60 (Myc-DDK tagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PUF60 (Myc-DDK tagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PUF60 (Myc-DDK tagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PUF60 (GFP-tagged) - Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PUF60 (GFP-tagged) - Human poly-U binding splicing factor 60KDa (PUF60), transcript variant c

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PUF60 (GFP-tagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 8

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PUF60 (GFP-tagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PUF60 (GFP-tagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PUF60 (GFP-tagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PUF60 (GFP-tagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-PUF60 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PUF60 antibody: synthetic peptide directed towards the C terminal of human PUF60. Synthetic peptide located within the following region: EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA

Rabbit Polyclonal Anti-PUF60 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PUF60 antibody: synthetic peptide directed towards the C terminal of human PUF60. Synthetic peptide located within the following region: EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA

Rabbit Polyclonal Anti-PUF60 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PUF60 antibody: synthetic peptide directed towards the C terminal of human PUF60. Synthetic peptide located within the following region: PPIPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQ

PUF60 (untagged)-Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal antibody to PUF60 (poly-U binding splicing factor 60KDa)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 346 and 523 of PUF60 (Uniprot ID#Q9UHX1)

PUF60 (untagged)-Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Goat Polyclonal Antibody against SIAHBP1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-YDQERFDNSDLSA, from the C Terminus of the protein sequence according to NP_510965.1; NP_055096.2.

PUF60 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PUF60 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of poly-U binding splicing factor 60KDa (PUF60), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of poly-U binding splicing factor 60KDa (PUF60), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PUF60 MS Standard C13 and N15-labeled recombinant protein (NP_055096)

Tag C-Myc/DDK
Expression Host HEK293

PUF60 MS Standard C13 and N15-labeled recombinant protein (NP_510965)

Tag C-Myc/DDK
Expression Host HEK293

PUF60 (untagged)-Human fuse-binding protein-interacting repressor, mRNA (cDNA clone MGC:9958 IMAGE:3877563), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

PUF60 (untagged)-Human fuse-binding protein-interacting repressor, mRNA (cDNA clone MGC:18191 IMAGE:4155549), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

PUF60 (untagged)-Human poly-U binding splicing factor 60KDa (PUF60), transcript variant c

Vector pCMV6 series
Tag Tag Free

PUF60 (untagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 4

Vector pCMV6 series
Tag Tag Free

PUF60 (untagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 5

Vector pCMV6 series
Tag Tag Free

PUF60 (untagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 6

Vector pCMV6 series
Tag Tag Free

PUF60 (untagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 7

Vector pCMV6 series
Tag Tag Free

PUF60 (untagged) - Homo sapiens poly-U binding splicing factor 60KDa (PUF60), transcript variant 8

Vector pCMV6 series
Tag Tag Free