Products

cDNA Clones (11)
Antibodies (8)
Proteins (8)
Jump to Filters
View as table Download
SF3B14 (SF3B6) (NM_016047) Human Tagged ORF Clone
RC201866

USD 98.00

USD 390.00

In Stock

SF3B14 (Myc-DDK-tagged)-Human splicing factor 3B, 14 kDa subunit (SF3B14)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SF3B14 (SF3B6) (NM_016047) Human Tagged ORF Clone
RG201866

USD 460.00

In Stock

SF3B14 (GFP-tagged) - Human splicing factor 3B, 14 kDa subunit (SF3B14)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SF3B14 (SF3B6) (NM_016047) Human Tagged ORF Clone
RC201866L3

USD 620.00

3 Weeks

Lenti ORF clone of Human splicing factor 3B, 14 kDa subunit (SF3B14), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SF3B14 (SF3B6) (NM_016047) Human Tagged ORF Clone
RC201866L4

USD 620.00

3 Weeks

Lenti ORF clone of Human splicing factor 3B, 14 kDa subunit (SF3B14), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SF3B14 (SF3B6) Rabbit Polyclonal Antibody
TA315491

USD 345.00

In Stock

Rabbit polyclonal anti-SF3B14 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human SF3B14.
SF3B14 (SF3B6) Rabbit Polyclonal Antibody
TA343838

USD 475.00

5 Days

Rabbit Polyclonal Anti-SF3B14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3B14 antibody: synthetic peptide directed towards the N terminal of human SF3B14. Synthetic peptide located within the following region: MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRV
SF3B14 (SF3B6) Rabbit Polyclonal Antibody
TA343839

USD 475.00

5 Days

Rabbit Polyclonal Anti-SF3B14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3B14 antibody: synthetic peptide directed towards the middle region of human SF3B14. Synthetic peptide located within the following region: HLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
SF3B14 (SF3B6) (NM_016047) Human Tagged ORF Clone
RC201866L2

USD 620.00

3 Weeks

Lenti ORF clone of Human splicing factor 3B, 14 kDa subunit (SF3B14), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SF3B14 (SF3B6) (NM_016047) Human Over-expression Lysate
LC414228

USD 121.00

In Stock

SF3B6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SF3B14 (SF3B6) (NM_016047) Human Over-expression Lysate
LY414228

USD 396.00

In Stock

Transient overexpression lysate of splicing factor 3B, 14 kDa subunit (SF3B14)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SF3B14 (SF3B6) (NM_016047) Human Untagged Clone
SC107008

USD 310.00

In Stock

SF3B14 (untagged)-Human splicing factor 3B, 14 kDa subunit (SF3B14)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SF3B14 (SF3B6) (NM_016047) Human Recombinant Protein
TP760024

USD 215.00

In Stock

Recombinant protein of human splicing factor 3B, 14 kDa subunit (SF3B14), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
SF3B14 / SAP14 (1-125, His-tag) Human Protein
AR09860PU-L

USD 845.00

2 Weeks

SF3B14 / SAP14 (1-125, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
SF3B14 / SAP14 (1-125, His-tag) Human Protein
AR09860PU-N

USD 330.00

2 Weeks

SF3B14 / SAP14 (1-125, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
SF3B14 (SF3B6) Mouse Monoclonal Antibody [Clone ID: OTI8A1]
CF811148

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SF3B14 mouse monoclonal antibody,clone OTI8A1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SF3B14 (SF3B6) Mouse Monoclonal Antibody [Clone ID: OTI8A1]
TA811148

USD 379.00

In Stock

SF3B14 mouse monoclonal antibody,clone OTI8A1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SF3B14 (SF3B6) Mouse Monoclonal Antibody [Clone ID: OTI8A1]
TA811148S

USD 159.00

2 Days

SF3B14 mouse monoclonal antibody,clone OTI8A1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SF3B14 (SF3B6) (NM_016047) ICC Control Block
TB401866

USD 1,040.00

4 Weeks

Transient overexpression of SF3B6 (NM_016047) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SF3B14 (SF3B6) Cytosection
TS401866

USD 225.00

4 Weeks

Transient overexpression of SF3B6 (NM_016047) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SF3B14 (SF3B6) Cytosection
TS401866P5

USD 889.00

4 Weeks

Transient overexpression of SF3B6 (NM_016047) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack