GAA (Myc-DDK-tagged)-Human glucosidase, alpha, acid (GAA), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GAA (Myc-DDK-tagged)-Human glucosidase, alpha, acid (GAA), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GAA (Myc-DDK-tagged)-Human glucosidase, alpha, acid (GAA), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GAA (untagged)-Human glucosidase, alpha, acid (GAA), transcript variant 1
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Recombinant protein of human glucosidase, alpha; acid (GAA), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
GAA (Myc-DDK-tagged)-Human glucosidase, alpha, acid (GAA), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, GAA (Myc-DDK tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, GAA (mGFP-tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, GAA (Myc-DDK tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, GAA (mGFP-tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
GAA (GFP-tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human glucosidase, alpha; acid (GAA), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
GAA (GFP-tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, GAA (Myc-DDK tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human glucosidase, alpha; acid (GAA), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GAA (Myc-DDK tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human glucosidase, alpha; acid (GAA), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GAA (mGFP-tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human glucosidase, alpha; acid (GAA), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human glucosidase, alpha; acid (GAA), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GAA (mGFP-tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human glucosidase, alpha; acid (GAA), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GAA (Myc-DDK tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human glucosidase, alpha; acid (GAA), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GAA (mGFP-tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GAA (GFP-tagged) - Human glucosidase, alpha; acid (GAA), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human glucosidase, alpha; acid (GAA), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human glucosidase, alpha; acid (GAA), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-GAA Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GAA antibody: synthetic peptide directed towards the N terminal of human GAA. Synthetic peptide located within the following region: FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL |
Lenti ORF clone of Human glucosidase, alpha; acid (GAA), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human glucosidase, alpha; acid (GAA), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
GAA (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | conjugated synthetic peptide between 173-203 amino acids from the N-terminal region of Human Alpha-glucosidase |
GAA (untagged)-Human glucosidase, alpha, acid (GAA), transcript variant 3
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human glucosidase, alpha, acid (GAA), with N-terminal His tag, secretory expressed in HEK293 cells, 20ug
Tag | N-His |
Expression Host | HEK293 |
GAA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
GAA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GAA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GAA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GAA MS Standard C13 and N15-labeled recombinant protein (NP_001073272)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
GAA MS Standard C13 and N15-labeled recombinant protein (NP_000143)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
GAA MS Standard C13 and N15-labeled recombinant protein (NP_001073271)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
GAA (untagged)-Human glucosidase, alpha, acid (GAA), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of GAA (NM_001079804) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GAA (NM_000152) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GAA (NM_001079803) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GAA (NM_001079804) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GAA (NM_001079804) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack