Products

View as table Download

PGM1 (Myc-DDK-tagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

PGM1 (Myc-DDK-tagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human phosphoglucomutase 1 (PGM1)

Tag C-Myc/DDK
Expression Host HEK293T

PGM1 (GFP-tagged) - Human phosphoglucomutase 1 (PGM1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human phosphoglucomutase 1 (PGM1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PGM1 (Myc-DDK tagged) - Human phosphoglucomutase 1 (PGM1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human phosphoglucomutase 1 (PGM1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PGM1 (mGFP-tagged) - Human phosphoglucomutase 1 (PGM1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PGM1 (Myc-DDK-tagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of PGM1 (Myc-DDK-tagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PGM1 (Myc-DDK-tagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PGM1 (mGFP-tagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PGM1 (mGFP-tagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PGM1 (Myc-DDK-tagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PGM1 (Myc-DDK-tagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PGM1 (mGFP-tagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PGM1 (mGFP-tagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PGM1 (GFP-tagged) - Human phosphoglucomutase 1 (PGM1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PGM1 (GFP-tagged) - Human phosphoglucomutase 1 (PGM1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PGM1 (untagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

PGM1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-PGM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGM1 antibody: synthetic peptide directed towards the middle region of human PGM1. Synthetic peptide located within the following region: TVEKADNFEYSDPVDGSISRNQGLRLIFTDGSRIVFRLSGTGSAGATIRL

Rabbit Polyclonal Anti-PGM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGM1 antibody: synthetic peptide directed towards the middle region of human PGM1. Synthetic peptide located within the following region: ATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVI

PGM1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PGM1 MS Standard C13 and N15-labeled recombinant protein (NP_002624)

Tag C-Myc/DDK
Expression Host HEK293

PGM1 (untagged)-Human phosphoglucomutase 1 (PGM1) transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

PGM1 (untagged)-Human phosphoglucomutase 1 (PGM1) transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

USD 1,130.00

4 Weeks

Transient overexpression of PGM1 (NM_002633) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,240.00

4 Weeks

Transient overexpression of PGM1 (NM_001172819) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,130.00

4 Weeks

Transient overexpression of PGM1 (NM_001172818) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of PGM1 (NM_002633) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of PGM1 (NM_002633) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of PGM1 (NM_001172819) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of PGM1 (NM_001172818) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of PGM1 (NM_001172818) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack