HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, HLA (Myc-DDK tagged) - Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, HLA (mGFP-tagged) - Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
HLA (Myc-DDK tagged) - Homo sapiens major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HLA (Myc-DDK tagged) - Homo sapiens major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HLA (GFP-tagged) - Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, HLA (Myc-DDK tagged) - Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, HLA (mGFP-tagged) - Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
HLA (GFP-tagged) - Homo sapiens major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HLA (GFP-tagged) - Homo sapiens major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
HLA (untagged)-Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-HA2Q antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HA2Q. |
Purified recombinant protein of Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug
Tag | N-GST and C-His |
Expression Host | E. coli |
Transient overexpression lysate of major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-HLA-DPA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HLA-DPA1 antibody: synthetic peptide directed towards the middle region of human HLA-DPA1. Synthetic peptide located within the following region: EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT |
HLA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
HLA (untagged) - Homo sapiens major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
HLA (untagged) - Homo sapiens major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of HLA (NM_033554) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HLA (NM_001242524) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HLA (NM_001242525) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HLA (NM_033554) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HLA (NM_033554) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of HLA (NM_001242524) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HLA (NM_001242524) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of HLA (NM_001242525) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HLA (NM_001242525) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack