Products

cDNA Clones (30)
Proteins (18)
Antibodies (6)
Jump to Filters
View as table Download
SMAD5 (NM_005903) Human Tagged ORF Clone
RC201949

USD 420.00

In Stock

SMAD5 (Myc-DDK-tagged)-Human SMAD family member 5 (SMAD5), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SMAD5 (NM_001001420) Human Tagged ORF Clone
RC224544

USD 420.00

In Stock

SMAD5 (Myc-DDK-tagged)-Human SMAD family member 5 (SMAD5), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SMAD5 (NM_001001419) Human Tagged ORF Clone
RC218788

USD 420.00

In Stock

SMAD5 (Myc-DDK-tagged)-Human SMAD family member 5 (SMAD5), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SMAD5 (NM_005903) Human Tagged ORF Clone Lentiviral Particle
RC201949L1V

USD 820.00

3 Weeks

Lenti ORF particles, SMAD5 (Myc-DDK tagged) - Human SMAD family member 5 (SMAD5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
SMAD5 (NM_005903) Human Tagged ORF Clone Lentiviral Particle
RC201949L2V

USD 820.00

6 Weeks

Lenti ORF particles, SMAD5 (mGFP-tagged) - Human SMAD family member 5 (SMAD5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SMAD5 (NM_001001420) Human Tagged ORF Clone Lentiviral Particle
RC224544L1V

USD 820.00

3 Weeks

Lenti ORF particles, SMAD5 (Myc-DDK tagged) - Human SMAD family member 5 (SMAD5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
SMAD5 (NM_001001420) Human Tagged ORF Clone Lentiviral Particle
RC224544L2V

USD 820.00

6 Weeks

Lenti ORF particles, SMAD5 (mGFP-tagged) - Human SMAD family member 5 (SMAD5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SMAD5 (NM_005903) Human Tagged ORF Clone
RG201949

USD 460.00

In Stock

SMAD5 (GFP-tagged) - Human SMAD family member 5 (SMAD5), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SMAD5 (NM_001001419) Human Tagged ORF Clone
RG218788

USD 460.00

In Stock

SMAD5 (GFP-tagged) - Human SMAD family member 5 (SMAD5), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SMAD5 (NM_005903) Human Tagged ORF Clone
RC201949L3

USD 620.00

3 Weeks

Lenti ORF clone of Human SMAD family member 5 (SMAD5), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAD5 (NM_005903) Human Tagged ORF Clone Lentiviral Particle
RC201949L3V

USD 820.00

5 Weeks

Lenti ORF particles, SMAD5 (Myc-DDK tagged) - Human SMAD family member 5 (SMAD5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAD5 (NM_005903) Human Tagged ORF Clone
RC201949L4

USD 620.00

3 Weeks

Lenti ORF clone of Human SMAD family member 5 (SMAD5), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAD5 (NM_005903) Human Tagged ORF Clone Lentiviral Particle
RC201949L4V

USD 820.00

7 Weeks

Lenti ORF particles, SMAD5 (mGFP-tagged) - Human SMAD family member 5 (SMAD5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAD5 (NM_001001419) Human Tagged ORF Clone
RC218788L3

USD 620.00

3 Weeks

Lenti ORF clone of Human SMAD family member 5 (SMAD5), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAD5 (NM_001001419) Human Tagged ORF Clone Lentiviral Particle
RC218788L3V

USD 820.00

6 Weeks

Lenti ORF particles, SMAD5 (Myc-DDK tagged) - Human SMAD family member 5 (SMAD5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAD5 (NM_001001419) Human Tagged ORF Clone
RC218788L4

USD 620.00

3 Weeks

Lenti ORF clone of Human SMAD family member 5 (SMAD5), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAD5 (NM_001001419) Human Tagged ORF Clone Lentiviral Particle
RC218788L4V

USD 820.00

6 Weeks

Lenti ORF particles, SMAD5 (mGFP-tagged) - Human SMAD family member 5 (SMAD5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAD5 (NM_001001420) Human Tagged ORF Clone
RC224544L3

USD 620.00

3 Weeks

Lenti ORF clone of Human SMAD family member 5 (SMAD5), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAD5 (NM_001001420) Human Tagged ORF Clone Lentiviral Particle
RC224544L3V

USD 820.00

5 Weeks

Lenti ORF particles, SMAD5 (Myc-DDK tagged) - Human SMAD family member 5 (SMAD5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAD5 (NM_001001420) Human Tagged ORF Clone
RC224544L4

USD 620.00

3 Weeks

Lenti ORF clone of Human SMAD family member 5 (SMAD5), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAD5 (NM_001001420) Human Tagged ORF Clone Lentiviral Particle
RC224544L4V

USD 820.00

7 Weeks

Lenti ORF particles, SMAD5 (mGFP-tagged) - Human SMAD family member 5 (SMAD5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAD5 (NM_001001420) Human Tagged ORF Clone
RG224544

USD 460.00

3 Weeks

SMAD5 (GFP-tagged) - Human SMAD family member 5 (SMAD5), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SMAD5 Rabbit Polyclonal Antibody
TA332472

USD 275.00

3 Weeks

Rabbit anti-SMAD5 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human SMAD5
SMAD5 (NM_005903) Human Tagged ORF Clone
RC201949L1

USD 768.00

In Stock

Lenti ORF clone of Human SMAD family member 5 (SMAD5), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SMAD5 (NM_001001420) Human Tagged ORF Clone
RC224544L1

USD 768.00

In Stock

Lenti ORF clone of Human SMAD family member 5 (SMAD5), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SMAD5 (NM_005903) Human Untagged Clone
SC116436

USD 760.00

In Stock

SMAD5 (untagged)-Human SMAD family member 5 (SMAD5), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SMAD5 Mouse Monoclonal Antibody [Clone ID: 4B10-B10-B6]
TA347048

USD 380.00

4 Weeks

Mouse Monoclonal SMAD5 (C-terminus) Antibody

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
SMAD5 (NM_005903) Human Recombinant Protein
TP760815

USD 215.00

In Stock

Purified recombinant protein of Human SMAD family member 5 (SMAD5), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli
SMAD5 (NM_005903) Human Tagged ORF Clone
RC201949L2

USD 620.00

3 Weeks

Lenti ORF clone of Human SMAD family member 5 (SMAD5), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SMAD5 (NM_001001420) Human Tagged ORF Clone
RC224544L2

USD 620.00

3 Weeks

Lenti ORF clone of Human SMAD family member 5 (SMAD5), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SMAD5 (NM_005903) Human Over-expression Lysate
LC416990

USD 121.00

In Stock

SMAD5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SMAD5 (NM_001001419) Human Over-expression Lysate
LC424347

USD 187.00

In Stock

SMAD5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SMAD5 (NM_005903) Human Over-expression Lysate
LY416990

USD 396.00

5 Days

Transient overexpression lysate of SMAD family member 5 (SMAD5), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SMAD5 (NM_005903) Human Untagged Clone
SC322346

USD 760.00

In Stock

SMAD5 (untagged)-Human SMAD family member 5 (SMAD5), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
SMAD5 (NM_001001419) Human Over-expression Lysate
LY424347

USD 605.00

5 Days

Transient overexpression lysate of SMAD family member 5 (SMAD5), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SMAD5 Rabbit Polyclonal Antibody
TA329743

USD 375.00

5 Days

Rabbit Polyclonal Anti-SMAD5 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SMAD5 antibody: synthetic peptide directed towards the middle region of human SMAD5. Synthetic peptide located within the following region: YPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMD
SMAD5 Rabbit Polyclonal Antibody
TA329744

USD 310.00

5 Days

Rabbit Polyclonal Anti-SMAD5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMAD5 antibody: synthetic peptide directed towards the middle region of human SMAD5. Synthetic peptide located within the following region: YPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMD
SMAD5 (NM_001001420) Human Over-expression Lysate
LC424348

USD 187.00

2 Weeks

SMAD5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SMAD5 (NM_001001420) Human Over-expression Lysate
LC425026

USD 121.00

2 Weeks

SMAD5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SMAD5 (NM_001001420) Human Over-expression Lysate
LY424348

USD 605.00

5 Days

Transient overexpression lysate of SMAD family member 5 (SMAD5), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY424348 is the same product as LY425026.
SMAD5 (NM_001001420) Human Over-expression Lysate
LY425026

USD 396.00

5 Days

Transient overexpression lysate of SMAD family member 5 (SMAD5), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SMAD5 (NM_001001419) Human Untagged Clone
SC300183

USD 760.00

3 Weeks

SMAD5 (untagged)-Human SMAD family member 5 (SMAD5), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SMAD5 (NM_001001420) Human Untagged Clone
SC300184

USD 760.00

3 Weeks

SMAD5 (untagged)-Human SMAD family member 5 (SMAD5), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SMAD5 Rabbit Polyclonal Antibody
TA323512

USD 345.00

In Stock

Anti-SMAD5 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from C terminal 300 amino acids of human SMAD family member 5
SMAD5 Rabbit Polyclonal Antibody
TA323513

USD 345.00

In Stock

Anti-SMAD5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from C terminal 300 amino acids of human SMAD family member 5
SMAD5 ICC Control Block
TB401949

USD 1,070.00

4 Weeks

Transient overexpression of SMAD5 (NM_005903) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SMAD5 ICC Control Block
TB418788

USD 1,070.00

4 Weeks

Transient overexpression of SMAD5 (NM_001001419) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SMAD5 ICC Control Block
TB424544

USD 1,070.00

4 Weeks

Transient overexpression of SMAD5 (NM_001001420) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SMAD5 Cytosection
TS401949

USD 225.00

4 Weeks

Transient overexpression of SMAD5 (NM_005903) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SMAD5 Cytosection
TS401949P5

USD 889.00

4 Weeks

Transient overexpression of SMAD5 (NM_005903) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack