Products

cDNA Clones (11)
Proteins (6)
Antibodies (4)
Jump to Filters
View as table Download
Kv2.1 (KCNB1) (NM_004975) Human Tagged ORF Clone
RC224667

USD 750.00

In Stock

KCNB1 (Myc-DDK-tagged)-Human potassium voltage-gated channel, Shab-related subfamily, member 1 (KCNB1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Kv2.1 (KCNB1) (NM_004975) Human Tagged ORF Clone Lentiviral Particle
RC224667L1V

USD 1,150.00

3 Weeks

Lenti ORF particles, KCNB1 (Myc-DDK tagged) - Human potassium voltage-gated channel, Shab-related subfamily, member 1 (KCNB1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Kv2.1 (KCNB1) (NM_004975) Human Tagged ORF Clone Lentiviral Particle
RC224667L2V

USD 1,150.00

6 Weeks

Lenti ORF particles, KCNB1 (mGFP-tagged) - Human potassium voltage-gated channel, Shab-related subfamily, member 1 (KCNB1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Kv2.1 (KCNB1) (NM_004975) Human Tagged ORF Clone
RG224667

USD 830.00

In Stock

KCNB1 (GFP-tagged) - Human potassium voltage-gated channel, Shab-related subfamily, member 1 (KCNB1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Kv2.1 (KCNB1) (NM_004975) Human Tagged ORF Clone
RC224667L3

USD 950.00

3 Weeks

Lenti ORF clone of Human potassium voltage-gated channel, Shab-related subfamily, member 1 (KCNB1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Kv2.1 (KCNB1) (NM_004975) Human Tagged ORF Clone Lentiviral Particle
RC224667L3V

USD 1,150.00

5 Weeks

Lenti ORF particles, KCNB1 (Myc-DDK tagged) - Human potassium voltage-gated channel, Shab-related subfamily, member 1 (KCNB1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Kv2.1 (KCNB1) (NM_004975) Human Tagged ORF Clone
RC224667L4

USD 950.00

3 Weeks

Lenti ORF clone of Human potassium voltage-gated channel, Shab-related subfamily, member 1 (KCNB1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kv2.1 (KCNB1) (NM_004975) Human Tagged ORF Clone Lentiviral Particle
RC224667L4V

USD 1,150.00

7 Weeks

Lenti ORF particles, KCNB1 (mGFP-tagged) - Human potassium voltage-gated channel, Shab-related subfamily, member 1 (KCNB1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kv2.1 (KCNB1) (NM_004975) Human Tagged ORF Clone
RC224667L1

USD 1,176.00

In Stock

Lenti ORF clone of Human potassium voltage-gated channel, Shab-related subfamily, member 1 (KCNB1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Kv2.1 (KCNB1) (NM_004975) Human Untagged Clone
SC117021

USD 1,750.00

In Stock

KCNB1 (untagged)-Human potassium voltage-gated channel, Shab-related subfamily, member 1 (KCNB1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Kv2.1 (KCNB1) (NM_004975) Human Tagged ORF Clone
RC224667L2

USD 950.00

3 Weeks

Lenti ORF clone of Human potassium voltage-gated channel, Shab-related subfamily, member 1 (KCNB1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Kv2.1 (KCNB1) Rabbit Polyclonal Antibody
TA314122

USD 345.00

4 Weeks

Rabbit polyclonal Kv2.1 (Ser805) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Kv2.1 around the phosphorylation site of serine 805 (P-T-SP-P-K).
Modifications Phospho-specific
Kv2.1 (KCNB1) Rabbit Polyclonal Antibody
TA325605

USD 345.00

In Stock

Rabbit Polyclonal Kv2.1 (Ser805) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Kv2.1 around the phosphorylation site of Serine 805
Modifications Phospho-specific
Kv2.1 (KCNB1) (NM_004975) Human Over-expression Lysate
LC401551

USD 187.00

In Stock

KCNB1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Kv2.1 (KCNB1) (NM_004975) Human Over-expression Lysate
LY401551

USD 605.00

5 Days

Transient overexpression lysate of potassium voltage-gated channel, Shab-related subfamily, member 1 (KCNB1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Kv2.1 (KCNB1) (NM_004975) Human Recombinant Protein
TP762055

USD 215.00

In Stock

Purified recombinant protein of Human potassium voltage-gated channel, Shab-related subfamily, member 1 (KCNB1),Gln509-Cys813, with N-terminal His tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli
Kv2.1 (KCNB1) Rabbit Polyclonal Antibody
TA334712

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNB1 antibody: synthetic peptide directed towards the middle region of human KCNB1. Synthetic peptide located within the following region: YIDADTDDEGQLLYSVDSSPPKSLPGSTSPKFSTGTRSEKNHFESSPLPT
Kv2.1 (KCNB1) Rabbit Polyclonal Antibody
TA351147

USD 345.00

In Stock

Rabbit Polyclonal Anti-KCNB1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNB1
Kv2.1 (KCNB1) ICC Control Block
TB424667

USD 1,400.00

4 Weeks

Transient overexpression of KCNB1 (NM_004975) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Kv2.1 (KCNB1) Cytosection
TS424667

USD 225.00

4 Weeks

Transient overexpression of KCNB1 (NM_004975) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Kv2.1 (KCNB1) Cytosection
TS424667P5

USD 889.00

4 Weeks

Transient overexpression of KCNB1 (NM_004975) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack