Products

cDNA Clones (29)
Proteins (16)
Antibodies (5)
Jump to Filters
View as table Download
TAS1R1 (NM_138697) Human Tagged ORF Clone
RC219286

USD 420.00

In Stock

TAS1R1 (Myc-DDK-tagged)-Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
TAS1R1 (NM_177540) Human Tagged ORF Clone
RC212370

USD 540.00

In Stock

TAS1R1 (Myc-DDK-tagged)-Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
TAS1R1 (NM_177541) Human Tagged ORF Clone
RC212432

USD 420.00

In Stock

TAS1R1 (Myc-DDK-tagged)-Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
TAS1R1 (NM_177540) Human Tagged ORF Clone Lentiviral Particle
RC212370L1V

USD 940.00

3 Weeks

Lenti ORF particles, TAS1R1 (Myc-DDK tagged) - Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
TAS1R1 (NM_177540) Human Tagged ORF Clone Lentiviral Particle
RC212370L2V

USD 940.00

6 Weeks

Lenti ORF particles, TAS1R1 (mGFP-tagged) - Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
TAS1R1 (NM_138697) Human Tagged ORF Clone Lentiviral Particle
RC219286L1V

USD 820.00

3 Weeks

Lenti ORF particles, TAS1R1 (Myc-DDK tagged) - Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
TAS1R1 (NM_138697) Human Tagged ORF Clone Lentiviral Particle
RC219286L2V

USD 820.00

6 Weeks

Lenti ORF particles, TAS1R1 (mGFP-tagged) - Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
TAS1R1 (NM_138697) Human Tagged ORF Clone
RG219286

USD 460.00

In Stock

TAS1R1 (GFP-tagged) - Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TAS1R1 (NM_177540) Human Tagged ORF Clone
RG212370

USD 590.00

In Stock

TAS1R1 (GFP-tagged) - Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TAS1R1 (NM_177540) Human Tagged ORF Clone
RC212370L3

USD 740.00

3 Weeks

Lenti ORF clone of Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAS1R1 (NM_177540) Human Tagged ORF Clone Lentiviral Particle
RC212370L3V

USD 940.00

5 Weeks

Lenti ORF particles, TAS1R1 (Myc-DDK tagged) - Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAS1R1 (NM_177540) Human Tagged ORF Clone
RC212370L4

USD 740.00

3 Weeks

Lenti ORF clone of Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAS1R1 (NM_177540) Human Tagged ORF Clone Lentiviral Particle
RC212370L4V

USD 940.00

7 Weeks

Lenti ORF particles, TAS1R1 (mGFP-tagged) - Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAS1R1 (NM_177541) Human Tagged ORF Clone
RC212432L3

USD 620.00

3 Weeks

Lenti ORF clone of Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAS1R1 (NM_177541) Human Tagged ORF Clone Lentiviral Particle
RC212432L3V

USD 820.00

6 Weeks

Lenti ORF particles, TAS1R1 (Myc-DDK tagged) - Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAS1R1 (NM_177541) Human Tagged ORF Clone
RC212432L4

USD 620.00

3 Weeks

Lenti ORF clone of Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAS1R1 (NM_177541) Human Tagged ORF Clone Lentiviral Particle
RC212432L4V

USD 820.00

6 Weeks

Lenti ORF particles, TAS1R1 (mGFP-tagged) - Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAS1R1 (NM_138697) Human Tagged ORF Clone
RC219286L3

USD 620.00

3 Weeks

Lenti ORF clone of Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAS1R1 (NM_138697) Human Tagged ORF Clone Lentiviral Particle
RC219286L3V

USD 820.00

5 Weeks

Lenti ORF particles, TAS1R1 (Myc-DDK tagged) - Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAS1R1 (NM_138697) Human Tagged ORF Clone
RC219286L4

USD 620.00

3 Weeks

Lenti ORF clone of Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAS1R1 (NM_138697) Human Tagged ORF Clone Lentiviral Particle
RC219286L4V

USD 820.00

7 Weeks

Lenti ORF particles, TAS1R1 (mGFP-tagged) - Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAS1R1 (NM_177541) Human Tagged ORF Clone
RG212432

USD 460.00

3 Weeks

TAS1R1 (GFP-tagged) - Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TAS1R1 (NM_138697) Human Tagged ORF Clone
RC219286L1

USD 768.00

In Stock

Lenti ORF clone of Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
TAS1R1 (NM_177540) Human Tagged ORF Clone
RC212370L1

USD 912.00

In Stock

Lenti ORF clone of Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
TAS1R1 (NM_177540) Human Untagged Clone
SC125268

USD 1,000.00

In Stock

TAS1R1 (untagged)-Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 3

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
TAS1R1 (NM_138697) Human Untagged Clone
SC315972

USD 760.00

In Stock

TAS1R1 (untagged)-Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
TAS1R1 (NM_177540) Human Tagged ORF Clone
RC212370L2

USD 740.00

3 Weeks

Lenti ORF clone of Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
TAS1R1 (NM_138697) Human Tagged ORF Clone
RC219286L2

USD 620.00

3 Weeks

Lenti ORF clone of Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
TAS1R1 (Center) Rabbit Polyclonal Antibody
AP54153PU-N

USD 450.00

2 Weeks

TAS1R1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 322-351 amino acids from the Central region of human TAS1R1
TAS1R1 (NM_177540) Human Over-expression Lysate
LY403591

USD 605.00

5 Days

Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TAS1R1 Rabbit Polyclonal Antibody
TA317407

USD 425.00

5 Days

T1R1 / TAS1R1 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen T1R1 / TAS1R1 antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human TAS1R1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Marmoset (83%).
TAS1R1 Rabbit Polyclonal Antibody
TA317408

USD 425.00

5 Days

T1R1 / TAS1R1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Gorilla, Horse, Human, Pig
Conjugation Unconjugated
Immunogen Synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human TAS1R1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bovine, Cat, Dog, Elephant, Panda, Horse, Pig (100%); Marmoset, Mouse, Rat, Hamster, Rabbit
TAS1R1 Rabbit Polyclonal Antibody
TA337751

USD 375.00

5 Days

Rabbit Polyclonal Anti-TAS1R1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAS1R1 antibody is: synthetic peptide directed towards the C-terminal region of Human TAS1R1. Synthetic peptide located within the following region: NINETKIQWHGKDNQVPKSVCSSDCLEGHQRVVTGFHHCCFECVPCGAGT
TAS1R1 Rabbit Polyclonal Antibody
TA337910

USD 375.00

5 Days

Rabbit Polyclonal Anti-TAS1R1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAS1R1 antibody is: synthetic peptide directed towards the middle region of Human TAS1R1. Synthetic peptide located within the following region: QKRAVPGLKAFEEAYARADKKAPRPCHKGSWCSSNQLCRECQAFMAHTMP
TAS1R1 (NM_177540) Human Over-expression Lysate
LC403591

USD 187.00

2 Weeks

TAS1R1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TAS1R1 (NM_177541) Human Over-expression Lysate
LC406077

USD 121.00

2 Weeks

TAS1R1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TAS1R1 (NM_138697) Human Over-expression Lysate
LC408549

USD 187.00

2 Weeks

TAS1R1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TAS1R1 (NM_177541) Human Over-expression Lysate
LY406077

USD 396.00

5 Days

Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 4

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TAS1R1 (NM_138697) Human Over-expression Lysate
LY408549

USD 605.00

5 Days

Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TAS1R1 (NM_177540) Human Mass Spec Standard
PH312370

USD 2,055.00

3 Weeks

TAS1R1 MS Standard C13 and N15-labeled recombinant protein (NP_803884)

Tag C-Myc/DDK
Expression Host HEK293
TAS1R1 (NM_177541) Human Untagged Clone
SC307106

USD 660.00

3 Weeks

TAS1R1 (untagged)-Human taste receptor, type 1, member 1 (TAS1R1), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
TAS1R1 (NM_177540) ICC Control Block
TB412370

USD 1,190.00

4 Weeks

Transient overexpression of TAS1R1 (NM_177540) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TAS1R1 (NM_177541) ICC Control Block
TB412432

USD 1,070.00

4 Weeks

Transient overexpression of TAS1R1 (NM_177541) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TAS1R1 (NM_138697) ICC Control Block
TB419286

USD 1,070.00

4 Weeks

Transient overexpression of TAS1R1 (NM_138697) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TAS1R1 Cytosection
TS412370

USD 225.00

4 Weeks

Transient overexpression of TAS1R1 (NM_177540) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

TAS1R1 Cytosection
TS412370P5

USD 889.00

4 Weeks

Transient overexpression of TAS1R1 (NM_177540) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

TAS1R1 Cytosection
TS412432

USD 225.00

4 Weeks

Transient overexpression of TAS1R1 (NM_177541) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

TAS1R1 ICC Control Sections
TS412432P5

USD 889.00

4 Weeks

Transient overexpression of TAS1R1 (NM_177541) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

TAS1R1 Cytosection
TS419286

USD 225.00

4 Weeks

Transient overexpression of TAS1R1 (NM_138697) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

TAS1R1 Cytosection
TS419286P5

USD 889.00

4 Weeks

Transient overexpression of TAS1R1 (NM_138697) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack