Germany
Japan
United Kingdom
China
TAS2R5 (Myc-DDK-tagged)-Human taste receptor, type 2, member 5 (TAS2R5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
TAS2R5 (GFP-tagged) - Human taste receptor, type 2, member 5 (TAS2R5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human taste receptor, type 2, member 5 (TAS2R5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TAS2R5 (Myc-DDK tagged) - Human taste receptor, type 2, member 5 (TAS2R5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human taste receptor, type 2, member 5 (TAS2R5), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TAS2R5 (mGFP-tagged) - Human taste receptor, type 2, member 5 (TAS2R5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Transient overexpression lysate of taste receptor, type 2, member 5 (TAS2R5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-TAS2R5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAS2R5 Antibody is: synthetic peptide directed towards the C-terminal region of Human TAS2R5. Synthetic peptide located within the following region: SWQYLYAFQLNSGSYLPLVVFLVSSGMLIVSLYTHHKKMKVHSAGRRDVR |
TAS2R5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TAS2R5 (untagged)-Human taste receptor, type 2, member 5 (TAS2R5)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of TAS2R5 (NM_018980) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TAS2R5 (NM_018980) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TAS2R5 (NM_018980) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- TAS2R5
Pathways
- Taste transduction