CLDN1 (Myc-DDK-tagged)-Human claudin 1 (CLDN1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
CLDN1 (Myc-DDK-tagged)-Human claudin 1 (CLDN1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CLDN1 (untagged)-Human claudin 1 (CLDN1)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human claudin 1 (CLDN1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CLDN1 (GFP-tagged) - Human claudin 1 (CLDN1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, CLDN1 (Myc-DDK tagged) - Human claudin 1 (CLDN1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, CLDN1 (mGFP-tagged) - Human claudin 1 (CLDN1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
5 Weeks
Lenti ORF particles, CLDN1 (Myc-DDK tagged) - Human claudin 1 (CLDN1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human claudin 1 (CLDN1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal CLDN1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CLDN1 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of human CLDN1. The immunogen is located within the last 50 amino acids of CLDN1. |
Transient overexpression lysate of claudin 1 (CLDN1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CLDN1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CLDN1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CLDN1 |
Rabbit Polyclonal Anti-Claudin 1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Claudin 1 Antibody: A synthesized peptide derived from human Claudin 1 |
USD 480.00
2 Weeks
Claudin 1 (CLDN1) (full length) mouse monoclonal antibody, clone 1C5-D9, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Lenti ORF clone of Human claudin 1 (CLDN1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal Claudin 1 (Ab-210) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Claudin 1 around the phosphorylation site of tyrosine 210 (G-K-D-YP-V). |
Claudin 1 (CLDN1) (C-term) rabbit polyclonal antibody, Purified
Applications | IHC |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Immunogen | CLDN1 antibody was raised against a synthetic peptide derived from the C-terminus of human Claudin-1 |
Rabbit polyclonal anti-Claudin 1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Claudin 1. |
Rabbit Polyclonal Anti-CLDN1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLDN1 antibody: synthetic peptide directed towards the C terminal of human CLDN1. Synthetic peptide located within the following region: GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV |
Rabbit anti Claudin 1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide from C-terminus of human claudin 1 protein. |
CLDN1 MS Standard C13 and N15-labeled recombinant protein (NP_066924)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Anti-CLDN1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 196-209 amino acids of Human claudin 1 |
Anti-CLDN1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 196-209 amino acids of Human claudin 1 |
Transient overexpression of CLDN1 (NM_021101) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CLDN1 (NM_021101) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CLDN1 (NM_021101) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack