Products

cDNA Clones (16)
Antibodies (8)
Proteins (7)
Jump to Filters
View as table Download
Oligodendrocyte Specific Protein (CLDN11) (NM_005602) Human Tagged ORF Clone Lentiviral Particle
RC202087L3V

USD 820.00

5 Weeks

Lenti ORF particles, CLDN11 (Myc-DDK tagged) - Human claudin 11 (CLDN11), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Oligodendrocyte Specific Protein (CLDN11) (NM_005602) Human Tagged ORF Clone Lentiviral Particle
RC202087L4V

USD 820.00

3 Weeks

Lenti ORF particles, CLDN11 (mGFP-tagged) - Human claudin 11 (CLDN11), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Oligodendrocyte Specific Protein (CLDN11) (NM_001185056) Human Tagged ORF Clone Lentiviral Particle
RC230958L3V

USD 820.00

11 Weeks

Lenti ORF particles, CLDN11 (Myc-DDK-tagged)-Human claudin 11 (CLDN11), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Oligodendrocyte Specific Protein (CLDN11) (NM_001185056) Human Tagged ORF Clone Lentiviral Particle
RC230958L4V

USD 820.00

11 Weeks

Lenti ORF particles, CLDN11 (mGFP-tagged)-Human claudin 11 (CLDN11), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Oligodendrocyte Specific Protein (CLDN11) Rabbit Polyclonal Antibody
TA332574

USD 275.00

3 Weeks

Rabbit anti-CLDN11 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CLDN11
Oligodendrocyte Specific Protein (CLDN11) Rabbit Polyclonal Antibody
TA334203

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-CLDN11 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN11 antibody: synthetic peptide directed towards the C terminal of human CLDN11. Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH
Oligodendrocyte Specific Protein (CLDN11) Rabbit Polyclonal Antibody
TA347773

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Claudin 11 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 11 Antibody: A synthesized peptide derived from human Claudin 11
Oligodendrocyte Specific Protein (CLDN11) Rabbit Polyclonal Antibody
TA347992

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Claudin 11 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Cow
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 11 Antibody: A synthesized peptide derived from human Claudin 11
Oligodendrocyte Specific Protein (CLDN11) Rabbit Polyclonal Antibody
TA311648

USD 345.00

In Stock

Rabbit polyclonal Claudin 11 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Claudin 11.
Oligodendrocyte Specific Protein (CLDN11) (C-term) Rabbit Polyclonal Antibody
AP31210PU-N

USD 440.00

2 Weeks

Oligodendrocyte Specific Protein (CLDN11) (C-term) rabbit polyclonal antibody, Purified

Applications IHC
Reactivities Human, Mouse
Immunogen Synthetic peptide from C-terminal of human claudin 11 protein
Oligodendrocyte Specific Protein (CLDN11) Rabbit Polyclonal Antibody
TA351083

USD 345.00

In Stock

Rabbit Polyclonal Anti-CLDN11 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLDN11
Oligodendrocyte Specific Protein (CLDN11) ICC Control Block
TB402087

USD 1,040.00

4 Weeks

Transient overexpression of CLDN11 (NM_005602) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Oligodendrocyte Specific Protein (CLDN11) ICC Control Block
TB430958

USD 1,070.00

4 Weeks

Transient overexpression of CLDN11 (NM_001185056) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Oligodendrocyte Specific Protein (CLDN11) Cytosection
TS402087

USD 225.00

4 Weeks

Transient overexpression of CLDN11 (NM_005602) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Oligodendrocyte Specific Protein (CLDN11) Cytosection
TS402087P5

USD 889.00

4 Weeks

Transient overexpression of CLDN11 (NM_005602) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Oligodendrocyte Specific Protein (CLDN11) ICC Control Sections
TS430958P5

USD 889.00

4 Weeks

Transient overexpression of CLDN11 (NM_001185056) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack