CLDN17 (Myc-DDK-tagged)-Human claudin 17 (CLDN17)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CLDN17 (Myc-DDK-tagged)-Human claudin 17 (CLDN17)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, CLDN17 (Myc-DDK tagged) - Human claudin 17 (CLDN17), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, CLDN17 (mGFP-tagged) - Human claudin 17 (CLDN17), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CLDN17 (GFP-tagged) - Human claudin 17 (CLDN17)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human claudin 17 (CLDN17), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CLDN17 (Myc-DDK tagged) - Human claudin 17 (CLDN17), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human claudin 17 (CLDN17), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CLDN17 (mGFP-tagged) - Human claudin 17 (CLDN17), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human claudin 17 (CLDN17), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human claudin 17 (CLDN17), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CLDN17 (untagged)-Human claudin 17 (CLDN17)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CLDN17 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLDN17 antibody: synthetic peptide directed towards the middle region of human CLDN17. Synthetic peptide located within the following region: KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA |
CLDN17 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of claudin 17 (CLDN17)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression of CLDN17 (NM_012131) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CLDN17 (NM_012131) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CLDN17 (NM_012131) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack