Products

Proteins (15)
cDNA Clones (13)
Antibodies (4)
Jump to Filters
View as table Download
Junctional Adhesion Molecule 2 (JAM2) (NM_021219) Human Tagged ORF Clone Lentiviral Particle
RC204633L3V

USD 820.00

6 Weeks

Lenti ORF particles, JAM2 (Myc-DDK tagged) - Human junctional adhesion molecule 2 (JAM2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Junctional Adhesion Molecule 2 (JAM2) (NM_021219) Human Tagged ORF Clone Lentiviral Particle
RC204633L4V

USD 820.00

3 Weeks

Lenti ORF particles, JAM2 (mGFP-tagged) - Human junctional adhesion molecule 2 (JAM2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Junctional Adhesion Molecule 2 (JAM2) Rabbit Polyclonal Antibody
TA308335

USD 415.00

In Stock

Rabbit Polyclonal antibody to JAM-B (junctional adhesion molecule 2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 294 of JAM-B (Uniprot ID#P57087)
Junctional Adhesion Molecule 2 (JAM2) Goat Polyclonal Antibody
TA305924

USD 375.00

5 Days

Goat Anti-JAM2 / JAMB / CD322 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QRKGYFSKETSFQ, from the internal region of the protein sequence according to NP_067042.1.
Junctional Adhesion Molecule 2 (JAM2) Rabbit Polyclonal Antibody
TA338012

USD 375.00

5 Days

Rabbit Polyclonal Anti-JAM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JAM2 antibody is: synthetic peptide directed towards the middle region of Human JAM2. Synthetic peptide located within the following region: LVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPR
CD322 / JAM2 (21-238, His-tag) Human Protein
AR50698PU-N

USD 845.00

2 Weeks

CD322 / JAM2 (21-238, His-tag) human protein, 0.5 mg

Tag His-tag
Expression Host E. coli
CD322 / JAM2 (21-238, His-tag) Human Protein
AR50698PU-S

USD 330.00

2 Weeks

CD322 / JAM2 (21-238, His-tag) human protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Junctional Adhesion Molecule 2 (JAM2) (NM_021219) ICC Control Block
TB404633

USD 1,070.00

4 Weeks

Transient overexpression of JAM2 (NM_021219) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Junctional Adhesion Molecule 2 (JAM2) (NM_001270407) ICC Control Block
TB433583

USD 1,070.00

4 Weeks

Transient overexpression of JAM2 (NM_001270407) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Junctional Adhesion Molecule 2 (JAM2) (NM_001270408) ICC Control Block
TB433723

USD 1,070.00

4 Weeks

Transient overexpression of JAM2 (NM_001270408) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Junctional Adhesion Molecule 2 (JAM2) Cytosection
TS404633

USD 225.00

4 Weeks

Transient overexpression of JAM2 (NM_021219) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Junctional Adhesion Molecule 2 (JAM2) Cytosection
TS404633P5

USD 889.00

4 Weeks

Transient overexpression of JAM2 (NM_021219) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Junctional Adhesion Molecule 2 (JAM2) ICC Control Sections
TS433583P5

USD 889.00

4 Weeks

Transient overexpression of JAM2 (NM_001270407) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Junctional Adhesion Molecule 2 (JAM2) ICC Control Sections
TS433723P5

USD 889.00

4 Weeks

Transient overexpression of JAM2 (NM_001270408) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack