Products

cDNA Clones (14)
Proteins (10)
Antibodies (2)
Jump to Filters
View as table Download
Junctional Adhesion Molecule C (JAM3) (NM_032801) Human Tagged ORF Clone Lentiviral Particle
RC216073L3V

USD 820.00

5 Weeks

Lenti ORF particles, JAM3 (Myc-DDK tagged) - Human junctional adhesion molecule 3 (JAM3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Junctional Adhesion Molecule C (JAM3) (NM_032801) Human Tagged ORF Clone Lentiviral Particle
RC216073L4V

USD 820.00

7 Weeks

Lenti ORF particles, JAM3 (mGFP-tagged) - Human junctional adhesion molecule 3 (JAM3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
JAM3 / JAM-C (32-241, His-tag) Human Protein
AR50547PU-N

USD 845.00

2 Weeks

JAM3 / JAM-C (32-241, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Junctional Adhesion Molecule C (JAM3) Rabbit Polyclonal Antibody
TA328124

USD 450.00

5 Days

Rabbit polyclonal anti-JAM3 antibody (C-term)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This JAM3 antibody is generated from a rabbit immunized with a KLH conjugated synthetic peptide between 261-295 amino acids from the C-terminal region of human JAM3.
Junctional Adhesion Molecule C (JAM3) Rabbit Polyclonal Antibody
TA339629

USD 375.00

5 Days

Rabbit Polyclonal Anti-JAM3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JAM3 antibody: synthetic peptide directed towards the N terminal of human JAM3. Synthetic peptide located within the following region: SSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQ
JAM3 / JAM-C (32-241, His-tag) Human Protein
AR50547PU-S

USD 330.00

2 Weeks

JAM3 / JAM-C (32-241, His-tag) human recombinant protein, 20 µg

Tag His-tag
Expression Host E. coli
Junctional Adhesion Molecule C (JAM3) (NM_032801) ICC Control Block
TB416073

USD 1,070.00

4 Weeks

Transient overexpression of JAM3 (NM_032801) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Junctional Adhesion Molecule C (JAM3) (NM_001205329) ICC Control Block
TB433575

USD 1,070.00

4 Weeks

Transient overexpression of JAM3 (NM_001205329) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Junctional Adhesion Molecule C (JAM3) Cytosection
TS416073

USD 225.00

4 Weeks

Transient overexpression of JAM3 (NM_032801) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Junctional Adhesion Molecule C (JAM3) Cytosection
TS416073P5

USD 889.00

4 Weeks

Transient overexpression of JAM3 (NM_032801) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Junctional Adhesion Molecule C (JAM3) ICC Control Sections
TS433575P5

USD 889.00

4 Weeks

Transient overexpression of JAM3 (NM_001205329) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack