Products

cDNA Clones (31)
Proteins (7)
Antibodies (6)
Jump to Filters
View as table Download
PKC gamma (PRKCG) (NM_002739) Human Tagged ORF Clone
RG208502

USD 670.00

In Stock

PRKCG (GFP-tagged) - Human protein kinase C, gamma (PRKCG)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC gamma (PRKCG) (NM_002739) Human Untagged Clone
SC112717

USD 310.00

In Stock

PRKCG (untagged)-Human protein kinase C, gamma (PRKCG)

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
PKC gamma (PRKCG) (NM_002739) Human Tagged ORF Clone
RC208502L4

USD 810.00

3 Weeks

Lenti ORF clone of Human protein kinase C, gamma (PRKCG), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone
RC402628

USD 760.00

3 Weeks

PRKCG Mutant (R41P), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation R41P
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone
RC402629

USD 760.00

3 Weeks

PRKCG Mutant (G63v), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation G63v
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone
RC402630

USD 760.00

3 Weeks

PRKCG Mutant (C77S), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation C77S
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone
RC402631

USD 760.00

3 Weeks

PRKCG Mutant (H101Q), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation H101Q
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone
RC402632

USD 760.00

3 Weeks

PRKCG Mutant (H101Y), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation H101Y
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone
RC402633

USD 760.00

3 Weeks

PRKCG Mutant (C114Y), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation C114Y
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone
RC402634

USD 760.00

3 Weeks

PRKCG Mutant (G118D), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation G118D
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone
RC402635

USD 760.00

3 Weeks

PRKCG Mutant (S119F), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation S119F
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone
RC402636

USD 760.00

3 Weeks

PRKCG Mutant (S119P), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation S119P
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone
RC402637

USD 760.00

3 Weeks

PRKCG Mutant (G123E), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation G123E
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone
RC402638

USD 760.00

3 Weeks

PRKCG Mutant (G123R), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation G123R
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone
RC402639

USD 760.00

3 Weeks

PRKCG Mutant (Q127R), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation Q127R
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone
RC402640

USD 760.00

3 Weeks

PRKCG Mutant (G128D), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation G128D
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone
RC402641

USD 760.00

3 Weeks

PRKCG Mutant (C131Y), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation C131Y
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone
RC402642

USD 760.00

3 Weeks

PRKCG Mutant (C131R), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation C131R
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone
RC402643

USD 760.00

3 Weeks

PRKCG Mutant (v138E), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation v138E
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone
RC402644

USD 760.00

3 Weeks

PRKCG Mutant (G360S), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation G360S
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone
RC402645

USD 760.00

3 Weeks

PRKCG Mutant (S361G), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation S361G
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone
RC402646

USD 760.00

3 Weeks

PRKCG Mutant (F643L), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation F643L
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone
RC402647

USD 760.00

3 Weeks

PRKCG Mutant (R659S), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation R659S
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC gamma (PRKCG) (NM_002739) Human Mutant ORF Clone
RC402648

USD 760.00

3 Weeks

PRKCG Mutant (v692G), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation v692G
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC gamma (PRKCG) (NM_002739) Human Untagged Clone
SC323469

USD 760.00

In Stock

PRKCG (untagged)-Kinase deficient mutant (K380M) of Human protein kinase C, gamma (PRKCG)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PKC gamma (PRKCG) Rabbit Polyclonal Antibody
TA313070

USD 345.00

In Stock

Rabbit polyclonal anti-PRKCG antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PRKCG.
PKC gamma (PRKCG) Rabbit Polyclonal Antibody
TA326206

USD 345.00

In Stock

Rabbit polyclonal PRKCG (Ab-655) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PRKCG around the phosphorylation site of threonine 655 (A-L-TP-P-P).
PKC gamma (PRKCG) Rabbit Polyclonal Antibody
TA342148

USD 375.00

5 Days

Rabbit polyclonal Anti-PRKCG Antibody

Applications Assay, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the N terminal of human PRKCG. Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
PKC gamma (PRKCG) (NM_002739) Human Over-expression Lysate
LC419134

USD 121.00

In Stock

PRKCG HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PKC gamma (PRKCG) (C-term) Rabbit Polyclonal Antibody
AP23311PU-N

USD 405.00

2 Weeks

PKC gamma (PRKCG) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the C-terminal of human PKC gamma
PKC gamma (PRKCG) (NM_002739) Human Over-expression Lysate
LY419134

USD 396.00

5 Days

Transient overexpression lysate of protein kinase C, gamma (PRKCG)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PKC gamma (PRKCG) Rabbit Polyclonal Antibody
TA342149

USD 375.00

5 Days

Rabbit polyclonal Anti-PRKCG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the middle region of human PRKCG. Synthetic peptide located within the following region: WSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKG
PKC gamma (PRKCG) (NM_002739) Human Mass Spec Standard
PH308502

USD 2,055.00

3 Weeks

PRKCG MS Standard C13 and N15-labeled recombinant protein (NP_002730)

Tag C-Myc/DDK
Expression Host HEK293
PKC gamma (PRKCG) Rabbit Polyclonal Antibody
TA350905

USD 345.00

In Stock

Rabbit Polyclonal Anti-PRKCG Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRKCG
PKC gamma (PRKCG) ICC Control Block
TB408502

USD 1,260.00

4 Weeks

Transient overexpression of PRKCG (NM_002739) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PKC gamma (PRKCG) Cytosection
TS408502

USD 225.00

4 Weeks

Transient overexpression of PRKCG (NM_002739) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PKC gamma (PRKCG) Cytosection
TS408502P5

USD 889.00

4 Weeks

Transient overexpression of PRKCG (NM_002739) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack