Products

View as table Download

Recombinant protein of human protein kinase C, gamma (PRKCG)

Tag C-Myc/DDK
Expression Host HEK293T

PRKCG (GFP-tagged) - Human protein kinase C, gamma (PRKCG)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Prkcg (Myc-DDK-tagged) - Mouse protein kinase C, gamma (Prkcc)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PRKCG (untagged)-Human protein kinase C, gamma (PRKCG)

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None

Prkcg (GFP-tagged) - Mouse protein kinase C gamma (Prkcc), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Prkcg (Myc-DDK-tagged) - Mouse protein kinase C, gamma (Prkcc)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Prkcg (mGFP-tagged) - Mouse protein kinase C, gamma (Prkcc)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Prkcg (GFP-tagged) - Mouse protein kinase C, gamma (Prkcc), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Prkcg (myc-DDK-tagged) - Mouse protein kinase C, gamma (Prkcg), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human protein kinase C, gamma (PRKCG), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PRKCG Mutant (R41P), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation R41P
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PRKCG Mutant (G63v), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation G63v
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PRKCG Mutant (C77S), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation C77S
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PRKCG Mutant (H101Q), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation H101Q
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PRKCG Mutant (H101Y), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation H101Y
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PRKCG Mutant (C114Y), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation C114Y
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PRKCG Mutant (G118D), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation G118D
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PRKCG Mutant (S119F), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation S119F
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PRKCG Mutant (S119P), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation S119P
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PRKCG Mutant (G123E), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation G123E
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PRKCG Mutant (G123R), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation G123R
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PRKCG Mutant (Q127R), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation Q127R
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PRKCG Mutant (G128D), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation G128D
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PRKCG Mutant (C131Y), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation C131Y
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PRKCG Mutant (C131R), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation C131R
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PRKCG Mutant (v138E), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation v138E
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PRKCG Mutant (G360S), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation G360S
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PRKCG Mutant (S361G), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation S361G
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PRKCG Mutant (F643L), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation F643L
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PRKCG Mutant (R659S), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation R659S
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PRKCG Mutant (v692G), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA

Mutation v692G
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Prkcg (Myc-DDK-tagged ORF) - Rat protein kinase C, gamma (Prkcg), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Prkcg (Myc-DDK-tagged ORF) - Rat protein kinase C, gamma (Prkcg), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Prkcg (Myc-DDK-tagged ORF) - Rat protein kinase C, gamma (Prkcg), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Prkcg (mGFP-tagged ORF) - Rat protein kinase C, gamma (Prkcg), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Prkcg (GFP-tagged ORF) - Rat protein kinase C, gamma (Prkcg), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PRKCG (untagged)-Kinase deficient mutant (K380M) of Human protein kinase C, gamma (PRKCG)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Prkcg (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Rabbit polyclonal anti-PRKCG antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PRKCG.

Rabbit polyclonal PRKCG (Ab-655) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PRKCG around the phosphorylation site of threonine 655 (A-L-TP-P-P).

Rabbit polyclonal Anti-PRKCG Antibody

Applications Assay, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the N terminal of human PRKCG. Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL

PRKCG HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PRKCG (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100