Products

View as table Download

CYP1A1 (Myc-DDK-tagged)-Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1)

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, CYP1A1 (Myc-DDK tagged) - Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, CYP1A1 (mGFP-tagged) - Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

CYP1A1 (GFP-tagged) - Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CYP1A1 (untagged)-Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF particles, CYP1A1 (mGFP-tagged) - Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CYP1A1 (Myc-DDK tagged) - Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CYP1A1 (untagged)-Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-CYP1A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV

Rabbit Polyclonal Anti-CYP1A1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV

Lenti ORF clone of Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit anti-CYP1A1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CYP1A1

Rabbit Polyclonal Anti-Cytochrome P450 1A1/2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cytochrome P450 1A1/2 Antibody: A synthesized peptide derived from human Cytochrome P450 1A1/2

CYP1A1 (+CYP1A2) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 71-120 of Human CYP1A1.

Lenti ORF clone of Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit polyclonal Cytochrome P450 1A1/2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 1A1/2.

CYP1A1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Mouse monoclonal Anti-Cytochrome P450 1A1 and 1A2 Clone MC1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Goat Anti-cytochrome P450 1A1 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CQEKQLDENANVQ, from the internal region of the protein sequence according to NP_000490.1

Rabbit polyclonal anti-Cytochrome P450 (CYP1A1,CYP1A2) antibody

Reactivities Rat
Immunogen Cytochrome P450 (CYP1A1,CYP1A2)

Rabbit polyclonal anti-Cytochrome P450 (CYP1A1) antibody

Reactivities Rat
Immunogen Cytochrome P450 (CYP1A1)

CYP1A1 MS Standard C13 and N15-labeled recombinant protein (NP_000490)

Tag C-Myc/DDK
Expression Host HEK293

Anti-CYP1A1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human cytochrome P450, family 1, subfamily A, polypeptide 1

Rabbit Polyclonal Anti-CYP1A1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYP1A1

USD 1,130.00

4 Weeks

Transient overexpression of CYP1A1 (NM_000499) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Purified recombinant protein of Human cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1), full-length, with N-terminal Myc-ddk tag, expressed in E.coli, 50ug

Tag Myc-DDK
Expression Host E. coli

USD 225.00

4 Weeks

Transient overexpression of CYP1A1 (NM_000499) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of CYP1A1 (NM_000499) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack