Products

View as table Download

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, A (HLA-A)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

HLA (GFP-tagged) - Human major histocompatibility complex, class I, A (HLA-A)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HLA (GFP-tagged) - Homo sapiens major histocompatibility complex, class I, A (HLA-A), transcript variant 2 (A*01:01:01:01 allele)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HLA (Myc-DDK tagged) - Homo sapiens major histocompatibility complex, class I, A (HLA-A), transcript variant 2 (A*01:01:01:01 allele)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human major histocompatibility complex, class I, A (HLA-A), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit anti-HLA-A Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human HLA-A

Transient overexpression lysate of major histocompatibility complex, class I, A (HLA-A)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti ORF clone of Human major histocompatibility complex, class I, A (HLA-A), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

HLA (untagged)-Human major histocompatibility complex, class I, A (HLA-A)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Lenti ORF clone of Human major histocompatibility complex, class I, A (HLA-A), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

HLA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Rabbit Polyclonal Anti-HLA-A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-A antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-A. Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ

Mouse monoclonal Anti-HLA-A2 Clone BB7.2

Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HLA mouse monoclonal antibody, clone OTI4D11

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HLA mouse monoclonal antibody, clone OTI2D11

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HLA mouse monoclonal antibody, clone OTI3H6

Applications WB
Reactivities Human
Conjugation Unconjugated

HLA MS Standard C13 and N15-labeled recombinant protein (NP_002107)

Tag C-Myc/DDK
Expression Host HEK293

HLA (untagged) - Homo sapiens major histocompatibility complex, class I, A (HLA-A), transcript variant 2 (A*01:01:01:01 allele)

Vector pCMV6 series
Tag Tag Free

Transient overexpression of HLA-A (NM_002116) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of HLA-A (NM_001242758) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of HLA-A (NM_002116) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of HLA-A (NM_002116) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of HLA-A (NM_001242758) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of HLA-A (NM_001242758) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack