Products

cDNA Clones (7)
Proteins (5)
Antibodies (2)
Jump to Filters
View as table Download
HLA DM (HLA-DMA) (NM_006120) Human Tagged ORF Clone
RC203106

USD 98.00

USD 390.00

In Stock

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class II, DM alpha (HLA-DMA)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
HLA DM (HLA-DMA) (NM_006120) Human Tagged ORF Clone
RG203106

USD 460.00

In Stock

HLA (GFP-tagged) - Human major histocompatibility complex, class II, DM alpha (HLA-DMA)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HLA DM (HLA-DMA) (NM_006120) Human Tagged ORF Clone
RC203106L3

USD 620.00

3 Weeks

Lenti ORF clone of Human major histocompatibility complex, class II, DM alpha (HLA-DMA), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HLA DM (HLA-DMA) (NM_006120) Human Tagged ORF Clone Lentiviral Particle
RC203106L3V

USD 820.00

6 Weeks

Lenti ORF particles, HLA (Myc-DDK tagged) - Human major histocompatibility complex, class II, DM alpha (HLA-DMA), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HLA DM (HLA-DMA) (NM_006120) Human Tagged ORF Clone
RC203106L4

USD 620.00

3 Weeks

Lenti ORF clone of Human major histocompatibility complex, class II, DM alpha (HLA-DMA), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HLA DM (HLA-DMA) (NM_006120) Human Tagged ORF Clone Lentiviral Particle
RC203106L4V

USD 820.00

6 Weeks

Lenti ORF particles, HLA (mGFP-tagged) - Human major histocompatibility complex, class II, DM alpha (HLA-DMA), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HLA DM (HLA-DMA) (NM_006120) Human Untagged Clone
SC321601

USD 310.00

In Stock

HLA (untagged)-Human major histocompatibility complex, class II, DM alpha (HLA-DMA)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
HLA DM (HLA-DMA) (NM_006120) Human Over-expression Lysate
LC416850

USD 121.00

In Stock

HLA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HLA DM (HLA-DMA) Rabbit Polyclonal Antibody
TA308310

USD 415.00

5 Days

Rabbit polyclonal antibody to HLA-DMA (major histocompatibility complex, class II, DM alpha)

Applications IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 52 and 245 of HLA-DMA
HLA DM (HLA-DMA) Rabbit Polyclonal Antibody
TA343137

USD 375.00

5 Days

Rabbit Polyclonal Anti-HLA-DMA Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-HLA-DMA antibody: synthetic peptide directed towards the N terminal of human HLA-DMA. Synthetic peptide located within the following region: GLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEW
HLA DM (HLA-DMA) (NM_006120) Human Over-expression Lysate
LY416850

USD 396.00

5 Days

Transient overexpression lysate of major histocompatibility complex, class II, DM alpha (HLA-DMA)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HLA DM (HLA-DMA) ICC Control Block
TB403106

USD 1,040.00

4 Weeks

Transient overexpression of HLA-DMA (NM_006120) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HLA DM (HLA-DMA) Cytosection
TS403106

USD 225.00

4 Weeks

Transient overexpression of HLA-DMA (NM_006120) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

HLA DM (HLA-DMA) Cytosection
TS403106P5

USD 889.00

4 Weeks

Transient overexpression of HLA-DMA (NM_006120) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack