Germany
Japan
United Kingdom
China
HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class II, DM alpha (HLA-DMA)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
HLA (GFP-tagged) - Human major histocompatibility complex, class II, DM alpha (HLA-DMA)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human major histocompatibility complex, class II, DM alpha (HLA-DMA), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, HLA (Myc-DDK tagged) - Human major histocompatibility complex, class II, DM alpha (HLA-DMA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human major histocompatibility complex, class II, DM alpha (HLA-DMA), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, HLA (mGFP-tagged) - Human major histocompatibility complex, class II, DM alpha (HLA-DMA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
HLA (untagged)-Human major histocompatibility complex, class II, DM alpha (HLA-DMA)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
HLA-DMA - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
HLA HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-HLA-DMA Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-HLA-DMA antibody: synthetic peptide directed towards the N terminal of human HLA-DMA. Synthetic peptide located within the following region: GLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEW |
HLA-DMA CRISPRa kit - CRISPR gene activation of human major histocompatibility complex, class II, DM alpha
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene HLA
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene HLA
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Transient overexpression lysate of major histocompatibility complex, class II, DM alpha (HLA-DMA)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
3`UTR clone of major histocompatibility complex class II DM alpha (HLA-DMA) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
HLA-DMA (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR320476 is the updated version of SR302115.
Transient overexpression of HLA-DMA (NM_006120) in HEK293T cells paraffin embedded controls for ICC/IHC staining
HLA-DMA - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
HLA - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Transient overexpression of HLA-DMA (NM_006120) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HLA-DMA (NM_006120) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- HLA-DMA