HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class II, DM alpha (HLA-DMA)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class II, DM alpha (HLA-DMA)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HLA (GFP-tagged) - Human major histocompatibility complex, class II, DM alpha (HLA-DMA)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human major histocompatibility complex, class II, DM alpha (HLA-DMA), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, HLA (Myc-DDK tagged) - Human major histocompatibility complex, class II, DM alpha (HLA-DMA), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human major histocompatibility complex, class II, DM alpha (HLA-DMA), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, HLA (mGFP-tagged) - Human major histocompatibility complex, class II, DM alpha (HLA-DMA), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
HLA (untagged)-Human major histocompatibility complex, class II, DM alpha (HLA-DMA)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
HLA-DMA - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
E. coli Selection | Ampicillin |
Mammalian Cell Selection | Puromycin |
HLA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal antibody to HLA-DMA (major histocompatibility complex, class II, DM alpha)
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 52 and 245 of HLA-DMA |
Rabbit Polyclonal Anti-HLA-DMA Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for anti-HLA-DMA antibody: synthetic peptide directed towards the N terminal of human HLA-DMA. Synthetic peptide located within the following region: GLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEW |
HLA-DMA CRISPRa kit - CRISPR gene activation of human major histocompatibility complex, class II, DM alpha
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene HLA
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene HLA
Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Transient overexpression lysate of major histocompatibility complex, class II, DM alpha (HLA-DMA)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
3`UTR clone of major histocompatibility complex class II DM alpha (HLA-DMA) for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
HLA-DMA (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression of HLA-DMA (NM_006120) in HEK293T cells paraffin embedded controls for ICC/IHC staining
HLA-DMA - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
E. coli Selection | Chloramphenicol |
Mammalian Cell Selection | Puromycin |
HLA - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
Transient overexpression of HLA-DMA (NM_006120) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HLA-DMA (NM_006120) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack