Germany
Japan
United Kingdom
China
CUL5 (Myc-DDK-tagged)-Human cullin 5 (CUL5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Purified recombinant protein of Homo sapiens cullin 5 (CUL5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
USD 820.00
3 Weeks
Lenti ORF particles, CUL5 (Myc-DDK tagged) - Human cullin 5 (CUL5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, CUL5 (mGFP-tagged) - Human cullin 5 (CUL5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CUL5 (GFP-tagged) - Human cullin 5 (CUL5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cullin 5 (CUL5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, CUL5 (Myc-DDK tagged) - Human cullin 5 (CUL5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cullin 5 (CUL5), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, CUL5 (mGFP-tagged) - Human cullin 5 (CUL5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cullin 5 (CUL5), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human cullin 5 (CUL5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal antibody to Cullin5 (cullin 5)
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 113 and 583 of Cullin 5 (Uniprot ID#Q93034) |
Rabbit anti-CUL5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CUL5 |
Transient overexpression lysate of cullin 5 (CUL5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
CUL5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit polyclonal anti-Cul5 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 4-18 of Human Cul5 (N-terminus) coupled to KLH. |
Rabbit Polyclonal Anti-CUL5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CUL5 antibody: synthetic peptide directed towards the C terminal of human CUL5. Synthetic peptide located within the following region: VNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHH |
CUL5 MS Standard C13 and N15-labeled recombinant protein (NP_003469)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of CUL5 (NM_003478) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CUL5 (NM_003478) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CUL5 (NM_003478) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CUL5
Pathways
- Ubiquitin mediated proteolysis