Products

Antibodies (62)
cDNA Clones (25)
Proteins (19)
Jump to Filters
View as table Download
ABAT (NM_000663) Human Tagged ORF Clone
RC206793

USD 480.00

In Stock

ABAT (Myc-DDK-tagged)-Human 4-aminobutyrate aminotransferase (ABAT), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ABAT (NM_020686) Human Tagged ORF Clone
RC218980

USD 480.00

In Stock

ABAT (Myc-DDK-tagged)-Human 4-aminobutyrate aminotransferase (ABAT), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ABAT (NM_001127448) Human Tagged ORF Clone
RC225860

USD 480.00

In Stock

ABAT (Myc-DDK-tagged)-Human 4-aminobutyrate aminotransferase (ABAT), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ABAT (NM_000663) Human Tagged ORF Clone Lentiviral Particle
RC206793L1V

USD 880.00

3 Weeks

Lenti ORF particles, ABAT (Myc-DDK tagged) - Human 4-aminobutyrate aminotransferase (ABAT), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
ABAT (NM_000663) Human Tagged ORF Clone Lentiviral Particle
RC206793L2V

USD 880.00

6 Weeks

Lenti ORF particles, ABAT (mGFP-tagged) - Human 4-aminobutyrate aminotransferase (ABAT), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
ABAT (NM_020686) Human Tagged ORF Clone
RG218980

USD 530.00

In Stock

ABAT (GFP-tagged) - Human 4-aminobutyrate aminotransferase (ABAT), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ABAT (NM_000663) Human Tagged ORF Clone
RC206793L3

USD 680.00

3 Weeks

Lenti ORF clone of Human 4-aminobutyrate aminotransferase (ABAT), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABAT (NM_000663) Human Tagged ORF Clone Lentiviral Particle
RC206793L3V

USD 880.00

6 Weeks

Lenti ORF particles, ABAT (Myc-DDK tagged) - Human 4-aminobutyrate aminotransferase (ABAT), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABAT (NM_000663) Human Tagged ORF Clone
RC206793L4

USD 680.00

3 Weeks

Lenti ORF clone of Human 4-aminobutyrate aminotransferase (ABAT), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABAT (NM_000663) Human Tagged ORF Clone Lentiviral Particle
RC206793L4V

USD 880.00

6 Weeks

Lenti ORF particles, ABAT (mGFP-tagged) - Human 4-aminobutyrate aminotransferase (ABAT), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABAT (NM_020686) Human Tagged ORF Clone
RC218980L3

USD 680.00

3 Weeks

Lenti ORF clone of Human 4-aminobutyrate aminotransferase (ABAT), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABAT (NM_020686) Human Tagged ORF Clone Lentiviral Particle
RC218980L3V

USD 880.00

6 Weeks

Lenti ORF particles, ABAT (Myc-DDK tagged) - Human 4-aminobutyrate aminotransferase (ABAT), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABAT (NM_020686) Human Tagged ORF Clone
RC218980L4

USD 680.00

3 Weeks

Lenti ORF clone of Human 4-aminobutyrate aminotransferase (ABAT), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABAT (NM_020686) Human Tagged ORF Clone Lentiviral Particle
RC218980L4V

USD 880.00

6 Weeks

Lenti ORF particles, ABAT (mGFP-tagged) - Human 4-aminobutyrate aminotransferase (ABAT), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABAT (NM_001127448) Human Tagged ORF Clone
RC225860L3

USD 680.00

3 Weeks

Lenti ORF clone of Human 4-aminobutyrate aminotransferase (ABAT), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABAT (NM_001127448) Human Tagged ORF Clone Lentiviral Particle
RC225860L3V

USD 880.00

6 Weeks

Lenti ORF particles, ABAT (Myc-DDK tagged) - Human 4-aminobutyrate aminotransferase (ABAT), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABAT (NM_001127448) Human Tagged ORF Clone
RC225860L4

USD 680.00

3 Weeks

Lenti ORF clone of Human 4-aminobutyrate aminotransferase (ABAT), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABAT (NM_001127448) Human Tagged ORF Clone Lentiviral Particle
RC225860L4V

USD 880.00

6 Weeks

Lenti ORF particles, ABAT (mGFP-tagged) - Human 4-aminobutyrate aminotransferase (ABAT), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABAT (NM_000663) Human Tagged ORF Clone
RG206793

USD 530.00

3 Weeks

ABAT (GFP-tagged) - Human 4-aminobutyrate aminotransferase (ABAT), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ABAT (NM_001127448) Human Tagged ORF Clone
RG225860

USD 530.00

3 Weeks

ABAT (GFP-tagged) - Human 4-aminobutyrate aminotransferase (ABAT), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ABAT Rabbit Polyclonal Antibody
TA332592

USD 275.00

3 Weeks

Rabbit anti-ABAT Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABAT
ABAT (NM_020686) Human Untagged Clone
SC127432

USD 310.00

In Stock

ABAT (untagged)-Human 4-aminobutyrate aminotransferase (ABAT), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
ABAT (NM_000663) Human Tagged ORF Clone
RC206793L1

USD 680.00

In Stock

Lenti ORF clone of Human 4-aminobutyrate aminotransferase (ABAT), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ABAT (NM_000663) Human Tagged ORF Clone
RC206793L2

USD 680.00

3 Weeks

Lenti ORF clone of Human 4-aminobutyrate aminotransferase (ABAT), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ABAT (NM_000663) Human Untagged Clone
SC111922

USD 310.00

In Stock

ABAT (untagged)-Human 4-aminobutyrate aminotransferase (ABAT), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
ABAT (NM_000663) Human Over-expression Lysate
LC400218

USD 121.00

In Stock

ABAT HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
ABAT (NM_020686) Human Over-expression Lysate
LC412383

USD 121.00

In Stock

ABAT HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ABAT (NM_020686) Human Over-expression Lysate
LY412383

USD 396.00

In Stock

Transient overexpression lysate of 4-aminobutyrate aminotransferase (ABAT), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ABAT (NM_000663) Human Over-expression Lysate
LY400218

USD 396.00

5 Days

Transient overexpression lysate of 4-aminobutyrate aminotransferase (ABAT), nuclear gene encoding mitochondrial protein, transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ABAT Rabbit Polyclonal Antibody
TA339936

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABAT antibody: synthetic peptide directed towards the middle region of human ABAT. Synthetic peptide located within the following region: YRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATT
ABAT Rabbit Polyclonal Antibody
TA339937

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABAT antibody: synthetic peptide directed towards the middle region of human ABAT. Synthetic peptide located within the following region: IIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFW
ABAT Mouse Monoclonal Antibody [Clone ID: OTI3D2]
CF806896

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ABAT Mouse Monoclonal Antibody [Clone ID: OTI6H1]
CF806898

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI6H1 (formerly 6H1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ABAT Mouse Monoclonal Antibody [Clone ID: OTI7C4]
CF806964

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI7C4 (formerly 7C4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ABAT Mouse Monoclonal Antibody [Clone ID: OTI6H9]
CF806965

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI6H9 (formerly 6H9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ABAT Mouse Monoclonal Antibody [Clone ID: OTI1F10]
CF806966

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ABAT Mouse Monoclonal Antibody [Clone ID: OTI3F6]
CF806967

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ABAT Mouse Monoclonal Antibody [Clone ID: OTI6C9]
CF806968

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI6C9 (formerly 6C9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ABAT Mouse Monoclonal Antibody [Clone ID: OTI7H1]
CF806969

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI7H1 (formerly 7H1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ABAT Mouse Monoclonal Antibody [Clone ID: OTI4A10]
CF806970

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ABAT Mouse Monoclonal Antibody [Clone ID: OTI7E9]
CF806972

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI7E9 (formerly 7E9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ABAT (NM_001127448) Human Over-expression Lysate
LC426789

USD 121.00

2 Weeks

ABAT HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ABAT (NM_001127448) Human Over-expression Lysate
LY426789

USD 396.00

5 Days

Transient overexpression lysate of 4-aminobutyrate aminotransferase (ABAT), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ABAT (NM_000663) Human Mass Spec Standard
PH306793

USD 2,055.00

3 Weeks

ABAT MS Standard C13 and N15-labeled recombinant protein (NP_000654)

Tag C-Myc/DDK
Expression Host HEK293
ABAT (NM_020686) Human Mass Spec Standard
PH318980

USD 2,055.00

3 Weeks

ABAT MS Standard C13 and N15-labeled recombinant protein (NP_065737)

Tag C-Myc/DDK
Expression Host HEK293
ABAT (NM_001127448) Human Mass Spec Standard
PH325860

USD 2,055.00

3 Weeks

ABAT MS Standard C13 and N15-labeled recombinant protein (NP_001120920)

Tag C-Myc/DDK
Expression Host HEK293
ABAT (NM_001127448) Human Untagged Clone
SC323108

USD 760.00

3 Weeks

ABAT (untagged)-Human 4-aminobutyrate aminotransferase (ABAT), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ABAT Mouse Monoclonal Antibody [Clone ID: OTI3D2]
TA806896

USD 379.00

In Stock

ABAT mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated