Products

cDNA Clones (18)
Proteins (10)
Antibodies (2)
Jump to Filters
View as table Download
BCKDHA (NM_001164783) Human Tagged ORF Clone
RC228900

USD 420.00

In Stock

BCKDHA (Myc-DDK-tagged)-Human branched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
BCKDHA (NM_000709) Human Tagged ORF Clone Lentiviral Particle
RC204816L1V

USD 820.00

3 Weeks

Lenti ORF particles, BCKDHA (Myc-DDK-tagged)-Human branched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
BCKDHA (NM_000709) Human Tagged ORF Clone Lentiviral Particle
RC204816L2V

USD 820.00

6 Weeks

Lenti ORF particles, BCKDHA (mGFP-tagged)-Human branched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
BCKDHA (NM_000709) Human Tagged ORF Clone
RC204816

USD 420.00

In Stock

BCKDHA (Myc-DDK-tagged)-Human branched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
BCKDHA (NM_000709) Human Tagged ORF Clone
RC204816L3

USD 620.00

3 Weeks

Lenti-ORF clone of BCKDHA (Myc-DDK-tagged)-Human branched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BCKDHA (NM_000709) Human Tagged ORF Clone Lentiviral Particle
RC204816L3V

USD 820.00

5 Weeks

Lenti ORF particles, BCKDHA (Myc-DDK-tagged)-Human branched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BCKDHA (NM_000709) Human Tagged ORF Clone
RC204816L4

USD 620.00

3 Weeks

Lenti-ORF clone of BCKDHA (mGFP-tagged)-Human branched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BCKDHA (NM_000709) Human Tagged ORF Clone Lentiviral Particle
RC204816L4V

USD 820.00

11 Weeks

Lenti ORF particles, BCKDHA (mGFP-tagged)-Human branched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BCKDHA (NM_001164783) Human Tagged ORF Clone
RC228900L3

USD 620.00

3 Weeks

Lenti-ORF clone of BCKDHA (Myc-DDK-tagged)-Human branched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BCKDHA (NM_001164783) Human Tagged ORF Clone Lentiviral Particle
RC228900L3V

USD 820.00

6 Weeks

Lenti ORF particles, BCKDHA (Myc-DDK-tagged)-Human branched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BCKDHA (NM_001164783) Human Tagged ORF Clone
RC228900L4

USD 620.00

3 Weeks

Lenti-ORF clone of BCKDHA (mGFP-tagged)-Human branched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BCKDHA (NM_001164783) Human Tagged ORF Clone Lentiviral Particle
RC228900L4V

USD 820.00

6 Weeks

Lenti ORF particles, BCKDHA (mGFP-tagged)-Human branched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BCKDHA (NM_000709) Human Tagged ORF Clone
RG204816

USD 460.00

3 Weeks

BCKDHA (GFP-tagged) - Human branched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
BCKDHA (NM_001164783) Human Tagged ORF Clone
RG228900

USD 460.00

3 Weeks

BCKDHA (GFP-tagged) - Human branched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
BCKDHA (NM_000709) Human Tagged ORF Clone
RC204816L1

USD 768.00

In Stock

Lenti-ORF clone of BCKDHA (Myc-DDK-tagged)-Human branched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
BCKDHA (NM_001164783) Human Over-expression Lysate
LY431928

USD 396.00

In Stock

Transient overexpression lysate of branched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), nuclear gene encoding mitochondrial protein, transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
BCKDHA (C-term) Rabbit Polyclonal Antibody
AP17149PU-N

USD 450.00

2 Weeks

BCKDHA (C-term) rabbit polyclonal antibody

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected between aa 362-390 of the C-terminal region of human BCKDHA
BCKDHA (NM_000709) Human Tagged ORF Clone
RC204816L2

USD 620.00

3 Weeks

Lenti-ORF clone of BCKDHA (mGFP-tagged)-Human branched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
BCKDHA (NM_000709) Human Untagged Clone
SC119718

USD 310.00

In Stock

BCKDHA (untagged)-Human branched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
BCKDHA Rabbit Polyclonal Antibody
TA335154

USD 375.00

5 Days

Rabbit polyclonal Anti-BCKDHA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BCKDHA antibody: synthetic peptide directed towards the N terminal of human BCKDHA. Synthetic peptide located within the following region: NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY
BCKDHA (NM_001164783) Human Over-expression Lysate
LC431928

USD 121.00

In Stock

BCKDHA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
BCKDHA (46-445, His-tag) Human Protein
AR09884PU-N

USD 845.00

2 Weeks

BCKDHA (46-445, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
BCKDHA (46-445, His-tag) Human Protein
AR09884PU-S

USD 330.00

2 Weeks

BCKDHA (46-445, His-tag) human recombinant protein, 10 µg

Tag His-tag
Expression Host E. coli
BCKDHA (NM_001164783) Human Untagged Clone
SC327535

USD 760.00

3 Weeks

BCKDHA (untagged)-Human branched chain keto acid dehydrogenase E1 alpha polypeptide (BCKDHA) nuclear gene encoding mitochondrial protein transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
BCKDHA ICC Control Block
TB404816

USD 1,070.00

4 Weeks

Transient overexpression of BCKDHA (NM_000709) in HEK293T cells paraffin embedded controls for ICC/IHC staining

BCKDHA ICC Control Block
TB428900

USD 1,070.00

4 Weeks

Transient overexpression of BCKDHA (NM_001164783) in HEK293T cells paraffin embedded controls for ICC/IHC staining

BCKDHA Cytosection
TS404816

USD 225.00

4 Weeks

Transient overexpression of BCKDHA (NM_000709) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

BCKDHA Cytosection
TS404816P5

USD 889.00

4 Weeks

Transient overexpression of BCKDHA (NM_000709) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

BCKDHA Cytosection
TS428900

USD 225.00

4 Weeks

Transient overexpression of BCKDHA (NM_001164783) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

BCKDHA Cytosection
TS428900P5

USD 889.00

4 Weeks

Transient overexpression of BCKDHA (NM_001164783) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack