USD 98.00
USD 800.00
In Stock
VARS (Myc-DDK-tagged)-Human valyl-tRNA synthetase (VARS), nuclear gene encoding mitochondrial protein
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 98.00
USD 800.00
In Stock
VARS (Myc-DDK-tagged)-Human valyl-tRNA synthetase (VARS), nuclear gene encoding mitochondrial protein
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,540.00
3 Weeks
Lenti ORF particles, VARS (Myc-DDK tagged) - Human valyl-tRNA synthetase (VARS), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,540.00
6 Weeks
Lenti ORF particles, VARS (mGFP-tagged) - Human valyl-tRNA synthetase (VARS), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human valyl-tRNA synthetase (VARS), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,540.00
5 Weeks
Lenti ORF particles, VARS (Myc-DDK tagged) - Human valyl-tRNA synthetase (VARS), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,540.00
3 Weeks
Lenti ORF particles, VARS (mGFP-tagged) - Human valyl-tRNA synthetase (VARS), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
VARS (GFP-tagged) - Human valyl-tRNA synthetase (VARS), nuclear gene encoding mitochondrial protein
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of valyl-tRNA synthetase (VARS), nuclear gene encoding mitochondrial protein
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human valyl-tRNA synthetase (VARS), nuclear gene encoding mitochondrial protein, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-VARS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VARS antibody: synthetic peptide directed towards the middle region of human VARS. Synthetic peptide located within the following region: AQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQKML |
Rabbit Polyclonal Anti-VARS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VARS antibody: synthetic peptide directed towards the middle region of human VARS. Synthetic peptide located within the following region: VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVP |
VARS HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
VARS MS Standard C13 and N15-labeled recombinant protein (NP_006286)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
VARS (untagged)-Human valyl-tRNA synthetase (VARS), nuclear gene encoding mitochondrial protein
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of VARS (NM_006295) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of VARS (NM_006295) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of VARS (NM_006295) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack