Products

View as table Download

Lenti ORF particles, VARS (Myc-DDK tagged) - Human valyl-tRNA synthetase (VARS), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, VARS (mGFP-tagged) - Human valyl-tRNA synthetase (VARS), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

VARS (GFP-tagged) - Human valyl-tRNA synthetase (VARS), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Transient overexpression lysate of valyl-tRNA synthetase (VARS), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti ORF clone of Human valyl-tRNA synthetase (VARS), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-VARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VARS antibody: synthetic peptide directed towards the middle region of human VARS. Synthetic peptide located within the following region: AQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQKML

Rabbit Polyclonal Anti-VARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VARS antibody: synthetic peptide directed towards the middle region of human VARS. Synthetic peptide located within the following region: VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVP

VARS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

VARS MS Standard C13 and N15-labeled recombinant protein (NP_006286)

Tag C-Myc/DDK
Expression Host HEK293

VARS (untagged)-Human valyl-tRNA synthetase (VARS), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression of VARS (NM_006295) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of VARS (NM_006295) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of VARS (NM_006295) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack