GNA13 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
GNA13 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, GNA13 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, GNA13 (mGFP-tagged)-Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
GNA13 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-GNA13 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GNA13 |
Lenti-ORF clone of GNA13 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, GNA13 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GNA13 (mGFP-tagged)-Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, GNA13 (mGFP-tagged)-Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GNA13 (myc-DDK-tagged) - Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GNA13 (untagged)-Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti-ORF clone of GNA13 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13)
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit anti-GNA13 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GNA13 |
Lenti-ORF clone of GNA13 (mGFP-tagged)-Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13)
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GNA13 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GNA13 antibody is: synthetic peptide directed towards the N-terminal region of Human GNA13. Synthetic peptide located within the following region: GCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLK |
Rabbit Polyclonal Anti-GNA13 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GNA13 antibody is: synthetic peptide directed towards the N-terminal region of Human GNA13. Synthetic peptide located within the following region: SREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTI |
GNA13 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GNA13 (untagged) - Human guanine nucleotide binding protein (G protein), alpha 13 (GNA13), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of GNA13 (NM_006572) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GNA13 (NM_001282425) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GNA13 (NM_006572) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GNA13 (NM_006572) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GNA13 (NM_001282425) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack