PRKCG (Myc-DDK-tagged)-Human protein kinase C, gamma (PRKCG)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG (Myc-DDK-tagged)-Human protein kinase C, gamma (PRKCG)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human protein kinase C, gamma (PRKCG)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 1,010.00
3 Weeks
Lenti ORF particles, PRKCG (Myc-DDK tagged) - Human protein kinase C, gamma (PRKCG), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,010.00
3 Weeks
Lenti ORF particles, PRKCG (mGFP-tagged) - Human protein kinase C, gamma (PRKCG), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PRKCG (GFP-tagged) - Human protein kinase C, gamma (PRKCG)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PRKCG (untagged)-Human protein kinase C, gamma (PRKCG)
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human protein kinase C, gamma (PRKCG), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,010.00
5 Weeks
Lenti ORF particles, PRKCG (Myc-DDK tagged) - Human protein kinase C, gamma (PRKCG), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human protein kinase C, gamma (PRKCG), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,010.00
5 Weeks
Lenti ORF particles, PRKCG (mGFP-tagged) - Human protein kinase C, gamma (PRKCG), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PRKCG Mutant (R41P), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA
Mutation | R41P |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG Mutant (G63v), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA
Mutation | G63v |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG Mutant (C77S), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA
Mutation | C77S |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG Mutant (H101Q), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA
Mutation | H101Q |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG Mutant (H101Y), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA
Mutation | H101Y |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG Mutant (C114Y), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA
Mutation | C114Y |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG Mutant (G118D), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA
Mutation | G118D |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG Mutant (S119F), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA
Mutation | S119F |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG Mutant (S119P), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA
Mutation | S119P |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG Mutant (G123E), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA
Mutation | G123E |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG Mutant (G123R), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA
Mutation | G123R |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG Mutant (Q127R), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA
Mutation | Q127R |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG Mutant (G128D), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA
Mutation | G128D |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG Mutant (C131Y), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA
Mutation | C131Y |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG Mutant (C131R), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA
Mutation | C131R |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG Mutant (v138E), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA
Mutation | v138E |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG Mutant (G360S), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA
Mutation | G360S |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG Mutant (S361G), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA
Mutation | S361G |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG Mutant (F643L), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA
Mutation | F643L |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG Mutant (R659S), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA
Mutation | R659S |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG Mutant (v692G), Myc-DDK-tagged ORF clone of Homo sapiens protein kinase C, gamma (PRKCG) as transfection-ready DNA
Mutation | v692G |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG (untagged)-Kinase deficient mutant (K380M) of Human protein kinase C, gamma (PRKCG)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-PRKCG antibody
Applications | WB |
Reactivities | Human Mouse Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PRKCG. |
Rabbit polyclonal PRKCG (Ab-655) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PRKCG around the phosphorylation site of threonine 655 (A-L-TP-P-P). |
Rabbit polyclonal Anti-PRKCG Antibody
Applications | Assay, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the N terminal of human PRKCG. Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL |
PRKCG HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PKC gamma (PRKCG) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human PKC gamma |
Transient overexpression lysate of protein kinase C, gamma (PRKCG)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal Anti-PRKCG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the middle region of human PRKCG. Synthetic peptide located within the following region: WSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKG |
PRKCG MS Standard C13 and N15-labeled recombinant protein (NP_002730)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-PRKCG Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PRKCG |
Transient overexpression of PRKCG (NM_002739) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PRKCG (NM_002739) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PRKCG (NM_002739) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack