Germany
Japan
United Kingdom
China
CXADR (Myc-DDK-tagged)-Human coxsackie virus and adenovirus receptor (CXADR), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
CXADR (GFP-tagged) - Human coxsackie virus and adenovirus receptor (CXADR), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, CXADR (Myc-DDK tagged) - Human coxsackie virus and adenovirus receptor (CXADR), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CXADR (mGFP-tagged) - Human coxsackie virus and adenovirus receptor (CXADR), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human coxsackie virus and adenovirus receptor (CXADR), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CXADR (Myc-DDK tagged) - Human coxsackie virus and adenovirus receptor (CXADR), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, CXADR (mGFP-tagged) - Human coxsackie virus and adenovirus receptor (CXADR), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CXADR (Myc-DDK tagged) - Homo sapiens coxsackie virus and adenovirus receptor (CXADR), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CXADR (Myc-DDK tagged) - Homo sapiens coxsackie virus and adenovirus receptor (CXADR), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CXADR (Myc-DDK tagged) - Homo sapiens coxsackie virus and adenovirus receptor (CXADR), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CXADR (Myc-DDK tagged) - Homo sapiens coxsackie virus and adenovirus receptor (CXADR), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CXADR (GFP-tagged) - Homo sapiens coxsackie virus and adenovirus receptor (CXADR), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CXADR (GFP-tagged) - Homo sapiens coxsackie virus and adenovirus receptor (CXADR), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CXADR (GFP-tagged) - Homo sapiens coxsackie virus and adenovirus receptor (CXADR), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CXADR (GFP-tagged) - Homo sapiens coxsackie virus and adenovirus receptor (CXADR), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CXADR (untagged)-Human coxsackie virus and adenovirus receptor (CXADR), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human coxsackie virus and adenovirus receptor (CXADR), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human coxsackie virus and adenovirus receptor (CXADR), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of coxsackie virus and adenovirus receptor (CXADR)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CXADR (untagged)-Human coxsackie virus and adenovirus receptor (CXADR), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit anti-CXADR Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CXADR |
Lenti ORF clone of Human coxsackie virus and adenovirus receptor (CXADR), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal anti-CXADR antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CXADR. |
CXADR HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-CXADR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CXADR Antibody: synthetic peptide directed towards the N terminal of human CXADR. Synthetic peptide located within the following region: ILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCK |
Rabbit Polyclonal Anti-CXADR Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CXADR antibody was raised against synthetic 15 amino acid peptide from internal region of human CXADR. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bat, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Zebra finch, Platypus, Lizard (93%); Xenopus, Stickleback, Pufferfish, Zebrafish (80%). |
Rabbit Polyclonal Anti-CXADR Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | CXADR antibody was raised against synthetic 15 amino acid peptide from internal region of human CXADR. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon (100%); Monkey, Galago, Horse (93%); Marmoset, Mouse, Elephant, Panda, Bat, Bovine, Rabbit, Pig, Guinea pig (87%); Rat, Hamster (80%). |
CXADR (20-237, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
CXADR (20-237, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
CXADR (untagged) - Homo sapiens coxsackie virus and adenovirus receptor (CXADR), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
CXADR (untagged) - Homo sapiens coxsackie virus and adenovirus receptor (CXADR), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
CXADR (untagged) - Homo sapiens coxsackie virus and adenovirus receptor (CXADR), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
CXADR (untagged) - Homo sapiens coxsackie virus and adenovirus receptor (CXADR), transcript variant 5
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of CXADR (NM_001338) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CXADR (NM_001207065) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CXADR (NM_001207064) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CXADR (NM_001207063) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CXADR (NM_001207066) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human coxsackie virus and adenovirus receptor (CXADR)
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human coxsackie virus and adenovirus receptor (CXADR)
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human coxsackie virus and adenovirus receptor (CXADR)
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human coxsackie virus and adenovirus receptor (CXADR)
| Tag | C-His |
| Expression Host | HEK293 |
Transient overexpression of CXADR (NM_001338) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CXADR (NM_001338) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CXADR (NM_001207065) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CXADR (NM_001207064) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CXADR (NM_001207063) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CXADR (NM_001207066) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CXADR
Pathways
- Viral myocarditis