Products

cDNA Clones (17)
Proteins (12)
Antibodies (2)
Jump to Filters
View as table Download
HLA DP (HLA-DPA1) (NM_033554) Human Tagged ORF Clone
RC222843

USD 420.00

In Stock

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
HLA DP (HLA-DPA1) (NM_001242524) Human Tagged ORF Clone
RC233577

USD 420.00

In Stock

HLA (Myc-DDK tagged) - Homo sapiens major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
HLA DP (HLA-DPA1) (NM_001242525) Human Tagged ORF Clone
RC233578

USD 420.00

In Stock

HLA (Myc-DDK tagged) - Homo sapiens major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
HLA DP (HLA-DPA1) (NM_033554) Human Tagged ORF Clone
RG222843

USD 460.00

In Stock

HLA (GFP-tagged) - Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HLA DP (HLA-DPA1) (NM_033554) Human Tagged ORF Clone
RC222843L3

USD 620.00

3 Weeks

Lenti ORF clone of Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HLA DP (HLA-DPA1) (NM_033554) Human Tagged ORF Clone Lentiviral Particle
RC222843L3V

USD 820.00

5 Weeks

Lenti ORF particles, HLA (Myc-DDK tagged) - Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HLA DP (HLA-DPA1) (NM_033554) Human Tagged ORF Clone
RC222843L4

USD 620.00

3 Weeks

Lenti ORF clone of Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HLA DP (HLA-DPA1) (NM_033554) Human Tagged ORF Clone Lentiviral Particle
RC222843L4V

USD 820.00

7 Weeks

Lenti ORF particles, HLA (mGFP-tagged) - Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HLA DP (HLA-DPA1) (NM_001242524) Human Tagged ORF Clone
RG233577

USD 460.00

3 Weeks

HLA (GFP-tagged) - Homo sapiens major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HLA DP (HLA-DPA1) (NM_001242525) Human Tagged ORF Clone
RG233578

USD 460.00

3 Weeks

HLA (GFP-tagged) - Homo sapiens major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HLA DP (HLA-DPA1) (NM_033554) Human Tagged ORF Clone
RC222843L1

USD 768.00

In Stock

Lenti ORF clone of Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
HLA DP (HLA-DPA1) (NM_033554) Human Untagged Clone
SC120116

USD 420.00

In Stock

HLA (untagged)-Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
HLA DP (HLA-DPA1) (NM_033554) Human Tagged ORF Clone
RC222843L2

USD 620.00

3 Weeks

Lenti ORF clone of Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
HLA DP (HLA-DPA1) Rabbit Polyclonal Antibody
TA314008

USD 345.00

In Stock

Rabbit polyclonal anti-HA2Q antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human HA2Q.
HLA DP (HLA-DPA1) (NM_033554) Human Recombinant Protein
TP761836

USD 215.00

In Stock

Purified recombinant protein of Human major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
HLA DP (HLA-DPA1) (NM_033554) Human Over-expression Lysate
LY403253

USD 396.00

5 Days

Transient overexpression lysate of major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HLA DP (HLA-DPA1) Rabbit Polyclonal Antibody
TA342062

USD 375.00

5 Days

Rabbit Polyclonal Anti-HLA-DPA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-DPA1 antibody: synthetic peptide directed towards the middle region of human HLA-DPA1. Synthetic peptide located within the following region: EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT
HLA DP (HLA-DPA1) (NM_033554) Human Over-expression Lysate
LC403253

USD 121.00

2 Weeks

HLA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HLA DP (HLA-DPA1) (NM_001242524) Human Untagged Clone
SC331822

USD 310.00

3 Weeks

HLA (untagged) - Homo sapiens major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), transcript variant 2

Vector pCMV6 series
Tag Tag Free
HLA DP (HLA-DPA1) (NM_001242525) Human Untagged Clone
SC331823

USD 310.00

3 Weeks

HLA (untagged) - Homo sapiens major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1), transcript variant 3

Vector pCMV6 series
Tag Tag Free
HLA DP (HLA-DPA1) ICC Control Block
TB422843

USD 1,070.00

4 Weeks

Transient overexpression of HLA (NM_033554) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HLA DP (HLA-DPA1) ICC Control Block
TB433577

USD 1,070.00

4 Weeks

Transient overexpression of HLA (NM_001242524) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HLA DP (HLA-DPA1) ICC Control Block
TB433578

USD 1,070.00

4 Weeks

Transient overexpression of HLA (NM_001242525) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HLA DP (HLA-DPA1) Cytosection
TS422843

USD 225.00

4 Weeks

Transient overexpression of HLA (NM_033554) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

HLA DP (HLA-DPA1) Cytosection
TS422843P5

USD 889.00

4 Weeks

Transient overexpression of HLA (NM_033554) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

HLA DP (HLA-DPA1) Cytosection
TS433577

USD 225.00

4 Weeks

Transient overexpression of HLA (NM_001242524) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

HLA DP (HLA-DPA1) Cytosection
TS433577P5

USD 889.00

4 Weeks

Transient overexpression of HLA (NM_001242524) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

HLA DP (HLA-DPA1) Cytosection
TS433578

USD 225.00

4 Weeks

Transient overexpression of HLA (NM_001242525) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

HLA DP (HLA-DPA1) Cytosection
TS433578P5

USD 889.00

4 Weeks

Transient overexpression of HLA (NM_001242525) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack