Products

View as table Download

MYH1 (Myc-DDK-tagged)-Human myosin, heavy chain 1, skeletal muscle, adult (MYH1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

MYH1 (GFP-tagged) - Human myosin, heavy chain 1, skeletal muscle, adult (MYH1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-MYH1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MYH1

Rabbit Polyclonal Anti-MYH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYH1 antibody: synthetic peptide directed towards the N terminal of human MYH1. Synthetic peptide located within the following region: KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK

CMH1 (MYH7) (slow) mouse monoclonal antibody, clone IML-64, Purified

Applications IHC, WB
Reactivities Human, Rat

Mouse monoclonal Anti-Slow Skeletal Muscle Myosin Heavy Chain Clone 96J

Reactivities Chicken, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated

Mouse monoclonal Anti-Slow Skeletal Muscle Myosin Heavy Chain (SM1) Clone M14

Reactivities Chicken, Human, Mouse, Rat
Conjugation Unconjugated

Mouse monoclonal Anti-Striated Muscle Myosin Heavy Chains (SM1 and SM2) Clone 83B6

Reactivities Chicken, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated

MYH1 (untagged)-Human myosin, heavy chain 1, skeletal muscle, adult (MYH1)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression of MYH1 (NM_005963) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of MYH1 (NM_005963) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of MYH1 (NM_005963) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack