MYH1 (Myc-DDK-tagged)-Human myosin, heavy chain 1, skeletal muscle, adult (MYH1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
MYH1 (Myc-DDK-tagged)-Human myosin, heavy chain 1, skeletal muscle, adult (MYH1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MYH1 (GFP-tagged) - Human myosin, heavy chain 1, skeletal muscle, adult (MYH1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-MYH1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MYH1 |
Rabbit Polyclonal Anti-MYH1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MYH1 antibody: synthetic peptide directed towards the N terminal of human MYH1. Synthetic peptide located within the following region: KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK |
USD 405.00
2 Weeks
Myosin Heavy chain 1 (MYH1) (fast) mouse monoclonal antibody, clone MY-38, Purified
Applications | IHC, WB |
Reactivities | Human, Rabbit, Rat |
CMH1 (MYH7) (slow) mouse monoclonal antibody, clone IML-64, Purified
Applications | IHC, WB |
Reactivities | Human, Rat |
USD 1,140.00
9 Weeks
Mouse monoclonal Anti-Slow Skeletal Muscle Myosin Heavy Chain Clone 96J
Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
USD 1,140.00
2 Weeks
Mouse monoclonal Anti-Slow Skeletal Muscle Myosin Heavy Chain (SM1) Clone M14
Reactivities | Chicken, Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 1,140.00
9 Weeks
Mouse monoclonal Anti-Striated Muscle Myosin Heavy Chains (SM1 and SM2) Clone 83B6
Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
MYH1 (untagged)-Human myosin, heavy chain 1, skeletal muscle, adult (MYH1)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of MYH1 (NM_005963) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MYH1 (NM_005963) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MYH1 (NM_005963) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack