Products

Antibodies (6)
cDNA Clones (4)
Proteins (3)
Jump to Filters
View as table Download
myosin heavy chain 9 (MYH9) (NM_002473) Human Tagged ORF Clone
RC216605

USD 1,999.00

In Stock

MYH9 (Myc-DDK-tagged)-Human myosin, heavy chain 9, non-muscle (MYH9)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
myosin heavy chain 9 (MYH9) (NM_002473) Human Tagged ORF Clone
RG216605

USD 2,200.00

3 Weeks

MYH9 (GFP-tagged) - Human myosin, heavy chain 9, non-muscle (MYH9)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
myosin heavy chain 9 (MYH9) (NM_002473) Human Untagged Clone
SC128173

USD 3,980.00

In Stock

MYH9 (untagged)-Human myosin, heavy chain 9, non-muscle (MYH9)

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
myosin heavy chain 9 (MYH9) Rabbit Polyclonal Antibody
TA346515

USD 475.00

5 Days

Rabbit Polyclonal Anti-MYH9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYH9 antibody: synthetic peptide directed towards the middle region of human MYH9. Synthetic peptide located within the following region: DAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAK
Lymphotactin (XCL1) (22-114) Mouse Monoclonal Antibody [Clone ID: 1E1]
AM31697PU-N

USD 480.00

2 Weeks

Lymphotactin (XCL1) (22-114) mouse monoclonal antibody, clone 1E1, Purified

Applications ELISA, IHC, WB
Reactivities Human
myosin heavy chain 9 (MYH9) (AK025393) Human Untagged Clone
SC104993

USD 660.00

In Stock

(untagged)-Human cDNA: FLJ21740 fis, clone COLF4800, highly similar to HUMMYONM Human nonmuscle myosin heavy chain (NMHC) mRNA

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
myosin heavy chain 9 (MYH9) ICC Control Block
TB416605

USD 2,649.00

4 Weeks

Transient overexpression of MYH9 (NM_002473) in HEK293T cells paraffin embedded controls for ICC/IHC staining

myosin heavy chain 9 (MYH9) Cytosection
TS416605

USD 225.00

4 Weeks

Transient overexpression of MYH9 (NM_002473) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

myosin heavy chain 9 (MYH9) Cytosection
TS416605P5

USD 889.00

4 Weeks

Transient overexpression of MYH9 (NM_002473) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack