Germany
Japan
United Kingdom
China
Recombinant protein of human sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Products
View as table Download
SGCB (Myc-DDK-tagged)-Human sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
SGCB (GFP-tagged) - Human sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, SGCB (Myc-DDK tagged) - Human sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, SGCB (mGFP-tagged) - Human sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SGCB (untagged)-Human sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SGCB (Beta-sarcoglycan) (87-318, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Transient overexpression lysate of sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-SGCB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SGCB antibody is: synthetic peptide directed towards the middle region of Human SGCB. Synthetic peptide located within the following region: RIGPNGCDSMELHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGN |
Rabbit Polyclonal Anti-SGCB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SGCB antibody: synthetic peptide directed towards the middle region of human SGCB. Synthetic peptide located within the following region: FSTDYETHEFHLPSGVKSLNVQKASTERITSNATSDLNIKVDGRAIVRGN |
SGCB (Beta-sarcoglycan) (87-318, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
SGCB HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
SGCB MS Standard C13 and N15-labeled recombinant protein (NP_000223)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of SGCB (NM_000232) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SGCB (NM_000232) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SGCB (NM_000232) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- SGCB
Pathways
- Viral myocarditis