Products

cDNA Clones (39)
Proteins (20)
Antibodies (1)
Jump to Filters
View as table Download
PORCN (NM_203475) Human Tagged ORF Clone
RC223764

USD 420.00

In Stock

PORCN (Myc-DDK-tagged)-Human porcupine homolog (Drosophila) (PORCN), transcript variant D

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PORCN (NM_203473) Human Tagged ORF Clone
RC205717

USD 420.00

In Stock

PORCN (Myc-DDK-tagged)-Human porcupine homolog (Drosophila) (PORCN), transcript variant B

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PORCN (NM_203474) Human Tagged ORF Clone
RC223707

USD 420.00

In Stock

PORCN (Myc-DDK-tagged)-Human porcupine homolog (Drosophila) (PORCN), transcript variant C

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PORCN (NM_203473) Human Tagged ORF Clone Lentiviral Particle
RC205717L1V

USD 820.00

3 Weeks

Lenti ORF particles, PORCN (Myc-DDK tagged) - Human porcupine homolog (Drosophila) (PORCN), transcript variant B, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PORCN (NM_203473) Human Tagged ORF Clone Lentiviral Particle
RC205717L2V

USD 820.00

6 Weeks

Lenti ORF particles, PORCN (mGFP-tagged) - Human porcupine homolog (Drosophila) (PORCN), transcript variant B, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PORCN (NM_022825) Human Tagged ORF Clone
RC223490

USD 420.00

In Stock

PORCN (Myc-DDK-tagged)-Human porcupine homolog (Drosophila) (PORCN), transcript variant A

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PORCN (NM_203475) Human Tagged ORF Clone Lentiviral Particle
RC223764L1V

USD 820.00

3 Weeks

Lenti ORF particles, PORCN (Myc-DDK tagged) - Human porcupine homolog (Drosophila) (PORCN), transcript variant D, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PORCN (NM_203475) Human Tagged ORF Clone Lentiviral Particle
RC223764L2V

USD 820.00

6 Weeks

Lenti ORF particles, PORCN (mGFP-tagged) - Human porcupine homolog (Drosophila) (PORCN), transcript variant D, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PORCN (NM_203473) Human Tagged ORF Clone
RG205717

USD 460.00

In Stock

PORCN (GFP-tagged) - Human porcupine homolog (Drosophila) (PORCN), transcript variant B

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PORCN (NM_203475) Human Tagged ORF Clone
RG223764

USD 460.00

In Stock

PORCN (GFP-tagged) - Human porcupine homolog (Drosophila) (PORCN), transcript variant D

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PORCN (NM_203473) Human Tagged ORF Clone
RC205717L3

USD 620.00

3 Weeks

Lenti ORF clone of Human porcupine homolog (Drosophila) (PORCN), transcript variant B, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PORCN (NM_203473) Human Tagged ORF Clone Lentiviral Particle
RC205717L3V

USD 820.00

5 Weeks

Lenti ORF particles, PORCN (Myc-DDK tagged) - Human porcupine homolog (Drosophila) (PORCN), transcript variant B, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PORCN (NM_203473) Human Tagged ORF Clone
RC205717L4

USD 620.00

3 Weeks

Lenti ORF clone of Human porcupine homolog (Drosophila) (PORCN), transcript variant B, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PORCN (NM_203473) Human Tagged ORF Clone Lentiviral Particle
RC205717L4V

USD 820.00

7 Weeks

Lenti ORF particles, PORCN (mGFP-tagged) - Human porcupine homolog (Drosophila) (PORCN), transcript variant B, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PORCN (NM_022825) Human Tagged ORF Clone
RC223490L3

USD 620.00

3 Weeks

Lenti ORF clone of Human porcupine homolog (Drosophila) (PORCN), transcript variant A, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PORCN (NM_022825) Human Tagged ORF Clone Lentiviral Particle
RC223490L3V

USD 820.00

6 Weeks

Lenti ORF particles, PORCN (Myc-DDK tagged) - Human porcupine homolog (Drosophila) (PORCN), transcript variant A, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PORCN (NM_022825) Human Tagged ORF Clone
RC223490L4

USD 620.00

3 Weeks

Lenti ORF clone of Human porcupine homolog (Drosophila) (PORCN), transcript variant A, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PORCN (NM_022825) Human Tagged ORF Clone Lentiviral Particle
RC223490L4V

USD 820.00

6 Weeks

Lenti ORF particles, PORCN (mGFP-tagged) - Human porcupine homolog (Drosophila) (PORCN), transcript variant A, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PORCN (NM_203474) Human Tagged ORF Clone
RC223707L3

USD 620.00

3 Weeks

Lenti-ORF clone of PORCN (Myc-DDK-tagged)-Human porcupine homolog (Drosophila) (PORCN), transcript variant C

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PORCN (NM_203474) Human Tagged ORF Clone Lentiviral Particle
RC223707L3V

USD 820.00

6 Weeks

Lenti ORF particles, PORCN (Myc-DDK-tagged)-Human porcupine homolog (Drosophila) (PORCN), transcript variant C, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PORCN (NM_203474) Human Tagged ORF Clone
RC223707L4

USD 620.00

3 Weeks

Lenti-ORF clone of PORCN (mGFP-tagged)-Human porcupine homolog (Drosophila) (PORCN), transcript variant C

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PORCN (NM_203474) Human Tagged ORF Clone Lentiviral Particle
RC223707L4V

USD 820.00

6 Weeks

Lenti ORF particles, PORCN (mGFP-tagged)-Human porcupine homolog (Drosophila) (PORCN), transcript variant C, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PORCN (NM_203475) Human Tagged ORF Clone
RC223764L3

USD 620.00

3 Weeks

Lenti ORF clone of Human porcupine homolog (Drosophila) (PORCN), transcript variant D, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PORCN (NM_203475) Human Tagged ORF Clone Lentiviral Particle
RC223764L3V

USD 820.00

5 Weeks

Lenti ORF particles, PORCN (Myc-DDK tagged) - Human porcupine homolog (Drosophila) (PORCN), transcript variant D, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PORCN (NM_203475) Human Tagged ORF Clone
RC223764L4

USD 620.00

In Stock

Lenti ORF clone of Human porcupine homolog (Drosophila) (PORCN), transcript variant D, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PORCN (NM_203475) Human Tagged ORF Clone Lentiviral Particle
RC223764L4V

USD 820.00

3 Weeks

Lenti ORF particles, PORCN (mGFP-tagged) - Human porcupine homolog (Drosophila) (PORCN), transcript variant D, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PORCN (NM_001282167) Human Tagged ORF Clone
RC237849

USD 420.00

2 Weeks

PORCN (myc-DDK-tagged) - Human porcupine homolog (Drosophila) (PORCN), transcript variant F

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PORCN (NM_022825) Human Tagged ORF Clone
RG223490

USD 460.00

3 Weeks

PORCN (GFP-tagged) - Human porcupine homolog (Drosophila) (PORCN), transcript variant A

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PORCN (NM_203474) Human Tagged ORF Clone
RG223707

USD 460.00

3 Weeks

PORCN (GFP-tagged) - Human porcupine homolog (Drosophila) (PORCN), transcript variant C

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PORCN (NM_022825) Human Untagged Clone
SC316376

USD 760.00

In Stock

PORCN (untagged)-Human porcupine homolog (Drosophila) (PORCN), transcript variant A

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SC316376 is the updated version of SC111966.
PORCN (NM_203473) Human Tagged ORF Clone
RC205717L1

USD 768.00

In Stock

Lenti ORF clone of Human porcupine homolog (Drosophila) (PORCN), transcript variant B, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PORCN (NM_203475) Human Tagged ORF Clone
RC223764L1

USD 768.00

In Stock

Lenti ORF clone of Human porcupine homolog (Drosophila) (PORCN), transcript variant D, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PORCN (NM_203475) Human Untagged Clone
SC308204

USD 770.00

In Stock

PORCN (untagged)-Human porcupine homolog (Drosophila) (PORCN), transcript variant D

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
PORCN (NM_203475) Human Over-expression Lysate
LY403716

USD 605.00

5 Days

Transient overexpression lysate of porcupine homolog (Drosophila) (PORCN), transcript variant D

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PORCN Rabbit Polyclonal Antibody
TA338624

USD 375.00

In Stock

Rabbit Polyclonal Anti-PORCN Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PORCN antibody: synthetic peptide directed towards the N terminal of human PORCN. Synthetic peptide located within the following region: ACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQLHMVWVVLLSLLCYLVLF
PORCN (NM_203473) Human Tagged ORF Clone
RC205717L2

USD 620.00

3 Weeks

Lenti ORF clone of Human porcupine homolog (Drosophila) (PORCN), transcript variant B, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PORCN (NM_203475) Human Tagged ORF Clone
RC223764L2

USD 620.00

3 Weeks

Lenti ORF clone of Human porcupine homolog (Drosophila) (PORCN), transcript variant D, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PORCN (NM_203473) Human Over-expression Lysate
LY404284

USD 396.00

5 Days

Transient overexpression lysate of porcupine homolog (Drosophila) (PORCN), transcript variant B

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PORCN (NM_203474) Human Over-expression Lysate
LY404285

USD 605.00

In Stock

Transient overexpression lysate of porcupine homolog (Drosophila) (PORCN), transcript variant C

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PORCN (NM_203475) Human Over-expression Lysate
LC403716

USD 187.00

2 Weeks

PORCN HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PORCN (NM_203473) Human Over-expression Lysate
LC404284

USD 121.00

2 Weeks

PORCN HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PORCN (NM_203474) Human Over-expression Lysate
LC404285

USD 187.00

2 Weeks

PORCN HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PORCN (NM_001282167) Human Tagged ORF Clone
RG237849

USD 460.00

2 Weeks

PORCN (GFP-tagged) - Human porcupine homolog (Drosophila) (PORCN), transcript variant F

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PORCN (NM_203473) Human Untagged Clone
SC308202

USD 760.00

3 Weeks

PORCN (untagged)-Human porcupine homolog (Drosophila) (PORCN), transcript variant B

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PORCN (NM_203474) Human Untagged Clone
SC308203

USD 760.00

3 Weeks

PORCN (untagged)-Human porcupine homolog (Drosophila) (PORCN), transcript variant C

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PORCN (NM_001282167) Human Untagged Clone
SC335743

USD 380.00

2 Weeks

PORCN (untagged) - Human porcupine homolog (Drosophila) (PORCN), transcript variant F

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PORCN (NM_203473) ICC Control Block
TB405717

USD 1,070.00

4 Weeks

Transient overexpression of PORCN (NM_203473) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PORCN (NM_022825) ICC Control Block
TB423490

USD 1,070.00

4 Weeks

Transient overexpression of PORCN (NM_022825) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PORCN (NM_203474) ICC Control Block
TB423707

USD 1,070.00

4 Weeks

Transient overexpression of PORCN (NM_203474) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PORCN (NM_203475) ICC Control Block
TB423764

USD 1,070.00

4 Weeks

Transient overexpression of PORCN (NM_203475) in HEK293T cells paraffin embedded controls for ICC/IHC staining