Products

View as table Download

ALDH6A1 (Myc-DDK-tagged)-Human aldehyde dehydrogenase 6 family, member A1 (ALDH6A1), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human aldehyde dehydrogenase 6 family, member A1 (ALDH6A1), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, ALDH6A1 (Myc-DDK tagged) - Human aldehyde dehydrogenase 6 family, member A1 (ALDH6A1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, ALDH6A1 (mGFP-tagged) - Human aldehyde dehydrogenase 6 family, member A1 (ALDH6A1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

ALDH6A1 (GFP-tagged) - Human aldehyde dehydrogenase 6 family, member A1 (ALDH6A1), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human aldehyde dehydrogenase 6 family, member A1 (ALDH6A1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ALDH6A1 (Myc-DDK tagged) - Human aldehyde dehydrogenase 6 family, member A1 (ALDH6A1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human aldehyde dehydrogenase 6 family, member A1 (ALDH6A1), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ALDH6A1 (mGFP-tagged) - Human aldehyde dehydrogenase 6 family, member A1 (ALDH6A1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ALDH6A1 (myc-DDK-tagged) - Human aldehyde dehydrogenase 6 family, member A1 (ALDH6A1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ALDH6A1 (myc-DDK-tagged) - Human aldehyde dehydrogenase 6 family, member A1 (ALDH6A1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human aldehyde dehydrogenase 6 family, member A1 (ALDH6A1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human aldehyde dehydrogenase 6 family, member A1 (ALDH6A1), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

ALDH6A1 (untagged)-Human aldehyde dehydrogenase 6 family, member A1 (ALDH6A1), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Antibody against ALDH6A1 (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ALDH6A1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 367-396 amino acids from the C-terminal region of human ALDH6A1.

ALDH6A1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Transient overexpression lysate of aldehyde dehydrogenase 6 family, member A1 (ALDH6A1), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Goat Anti-ALDH6A1 (aa487-496) Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-SRSSFRGDTN, from the internal region of the protein sequence according to NP_005580.1.

ALDH6A1 (untagged)-Human aldehyde dehydrogenase 6 family, member A1 (ALDH6A1), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-ALDH6A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH6A1 antibody: synthetic peptide directed towards the middle region of human ALDH6A1. Synthetic peptide located within the following region: GQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQW

Rabbit Polyclonal Anti-ALDH6A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH6A1 antibody: synthetic peptide directed towards the middle region of human ALDH6A1. Synthetic peptide located within the following region: AVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLID

ALDH6A1 / MMSDH (34-535, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

ALDH6A1 / MMSDH (34-535, His-tag) human recombinant protein, 20 µg

Tag His-tag
Expression Host E. coli

ALDH6A1 MS Standard C13 and N15-labeled recombinant protein (NP_005580)

Tag C-Myc/DDK
Expression Host HEK293

ALDH6A1 (GFP-tagged) - Human aldehyde dehydrogenase 6 family, member A1 (ALDH6A1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ALDH6A1 (GFP-tagged) - Human aldehyde dehydrogenase 6 family, member A1 (ALDH6A1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ALDH6A1 (untagged) - Human aldehyde dehydrogenase 6 family, member A1 (ALDH6A1), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

ALDH6A1 (untagged) - Human aldehyde dehydrogenase 6 family, member A1 (ALDH6A1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Anti-ALDH6A1 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 6 family, member A1

Anti-ALDH6A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 6 family, member A1

USD 1,070.00

4 Weeks

Transient overexpression of ALDH6A1 (NM_005589) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of ALDH6A1 (NM_001278594) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,130.00

4 Weeks

Transient overexpression of ALDH6A1 (NM_001278593) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of ALDH6A1 (NM_005589) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of ALDH6A1 (NM_005589) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of ALDH6A1 (NM_001278594) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of ALDH6A1 (NM_001278593) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack