Germany
Japan
United Kingdom
China
ZMAT3 (Myc-DDK-tagged)-Human zinc finger, matrin-type 3 (ZMAT3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
ZMAT3 (Myc-DDK-tagged)-Human zinc finger, matrin-type 3 (ZMAT3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human zinc finger, matrin type 3 (ZMAT3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF clone of Human zinc finger, matrin-type 3 (ZMAT3), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, ZMAT3 (Myc-DDK tagged) - Human zinc finger, matrin-type 3 (ZMAT3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human zinc finger, matrin-type 3 (ZMAT3), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, ZMAT3 (mGFP-tagged) - Human zinc finger, matrin-type 3 (ZMAT3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human zinc finger, matrin-type 3 (ZMAT3), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, ZMAT3 (Myc-DDK tagged) - Human zinc finger, matrin-type 3 (ZMAT3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human zinc finger, matrin-type 3 (ZMAT3), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, ZMAT3 (mGFP-tagged) - Human zinc finger, matrin-type 3 (ZMAT3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ZMAT3 (GFP-tagged) - Human zinc finger, matrin-type 3 (ZMAT3), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ZMAT3 (GFP-tagged) - Human zinc finger, matrin-type 3 (ZMAT3), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ZMAT3 (untagged)-Human zinc finger, matrin-type 3 (ZMAT3), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ZMAT3 (untagged)-Human zinc finger, matrin-type 3 (ZMAT3), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-ZMAT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZMAT3 antibody: synthetic peptide directed towards the N terminal of human ZMAT3. Synthetic peptide located within the following region: EQDCALEELCKPLYCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSC |
ZMAT3 (1-289, His-tag) human protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
ZMAT3 (1-289, His-tag) human protein, 20 µg
| Tag | His-tag |
| Expression Host | E. coli |
ZMAT3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ZMAT3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of zinc finger, matrin type 3 (ZMAT3), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of zinc finger, matrin type 3 (ZMAT3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ZMAT3 MS Standard C13 and N15-labeled recombinant protein (NP_071915)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of ZMAT3 (NM_022470) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ZMAT3 (NM_152240) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ZMAT3 (NM_022470) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ZMAT3 (NM_022470) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ZMAT3 (NM_152240) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ZMAT3 (NM_152240) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ZMAT3
Pathways
- p53 signaling pathway