Products

View as table Download

CTH (Myc-DDK-tagged)-Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

CTH (Myc-DDK-tagged)-Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

CTH (GFP-tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CTH (Myc-DDK-tagged)-Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CTH (Myc-DDK tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CTH (mGFP-tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CTH (Myc-DDK tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CTH (mGFP-tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CTH (Myc-DDK tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CTH (mGFP-tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CTH (GFP-tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CTH (GFP-tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

CTH HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-CTH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTH antibody: synthetic peptide directed towards the C terminal of human CTH. Synthetic peptide located within the following region: ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLK

Rabbit Polyclonal Anti-CTH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTH antibody: synthetic peptide directed towards the N terminal of human CTH. Synthetic peptide located within the following region: VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF

CTH (untagged)-Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

CTH (1-405, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

CTH (1-405, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

Carrier-free (BSA/glycerol-free) CTH mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTH mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated

CTH HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

CTH MS Standard C13 and N15-labeled recombinant protein (NP_001893)

Tag C-Myc/DDK
Expression Host HEK293

CTH (untagged)-Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

CTH (Cystathionase) mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated

CTH (Cystathionase) mouse monoclonal antibody, clone OTI1E12 (formerly 1E12), Biotinylated

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Biotin

CTH (Cystathionase) mouse monoclonal antibody, clone OTI1E12 (formerly 1E12), HRP conjugated

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation HRP

CTH (Cystathionase) mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated

CTH (Cystathionase) mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated

CTH (Cystathionase) mouse monoclonal antibody, clone OTI2D6 (formerly 2D6), Biotinylated

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Biotin

CTH (Cystathionase) mouse monoclonal antibody, clone OTI2D6 (formerly 2D6), HRP conjugated

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation HRP

CTH (Cystathionase) mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated

Transient overexpression of CTH (NM_001902) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of CTH (NM_153742) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of CTH (NM_001190463) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Purified recombinant protein of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1

Tag tag free
Expression Host E. coli

Purified recombinant protein of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1

Tag tag free
Expression Host E. coli

Purified recombinant protein of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1

Tag tag free
Expression Host E. coli