PHGDH (Myc-DDK-tagged)-Human phosphoglycerate dehydrogenase (PHGDH)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PHGDH (Myc-DDK-tagged)-Human phosphoglycerate dehydrogenase (PHGDH)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human phosphoglycerate dehydrogenase (PHGDH)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Lenti ORF particles, PHGDH (Myc-DDK tagged) - Human phosphoglycerate dehydrogenase (PHGDH), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PHGDH (mGFP-tagged) - Human phosphoglycerate dehydrogenase (PHGDH), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PHGDH (GFP-tagged) - Human phosphoglycerate dehydrogenase (PHGDH)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human phosphoglycerate dehydrogenase (PHGDH), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PHGDH (Myc-DDK tagged) - Human phosphoglycerate dehydrogenase (PHGDH), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PHGDH (mGFP-tagged) - Human phosphoglycerate dehydrogenase (PHGDH), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PHGDH (untagged)-Human phosphoglycerate dehydrogenase (PHGDH)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human phosphoglycerate dehydrogenase (PHGDH), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human phosphoglycerate dehydrogenase (PHGDH), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human phosphoglycerate dehydrogenase (PHGDH), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of phosphoglycerate dehydrogenase (PHGDH)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
PHGDH (untagged)-Human phosphoglycerate dehydrogenase (PHGDH)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PHGDH mouse monoclonal antibody, clone 4A3-1D6, Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
Recombinant protein of human phosphoglycerate dehydrogenase (PHGDH), full length, with C-terminal DDK tag, expressed in sf9, 20ug
Tag | C-DDK |
Expression Host | Sf9 |
PHGDH HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Recombinant protein of human phosphoglycerate dehydrogenase (PHGDH), full length, with N-terminal HIS tag, expressed in sf9, 20ug
Tag | N-His |
Expression Host | Sf9 |
PHGDH (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human PHGDH |
Rabbit Polyclonal Anti-PHGDH Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PHGDH antibody: synthetic peptide directed towards the middle region of human PHGDH. Synthetic peptide located within the following region: CAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQF |
Rabbit Polyclonal Anti-PHGDH Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PHGDH antibody: synthetic peptide directed towards the middle region of human PHGDH. Synthetic peptide located within the following region: SLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPA |
Carrier-free (BSA/glycerol-free) PHGDH mouse monoclonal antibody, clone OTI5C4 (formerly 5C4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PHGDH mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PHGDH mouse monoclonal antibody, clone OTI9C2 (formerly 9C2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PHGDH MS Standard C13 and N15-labeled recombinant protein (NP_006614)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-PHGDH Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PHGDH |
PHGDH mouse monoclonal antibody, clone OTI5C4 (formerly 5C4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
PHGDH mouse monoclonal antibody, clone OTI5C4 (formerly 5C4), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PHGDH mouse monoclonal antibody, clone OTI5C4 (formerly 5C4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PHGDH mouse monoclonal antibody, clone OTI5C4 (formerly 5C4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PHGDH mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
PHGDH mouse monoclonal antibody, clone OTI4A1 (formerly 4A1), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PHGDH mouse monoclonal antibody, clone OTI4A1 (formerly 4A1), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PHGDH mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PHGDH mouse monoclonal antibody, clone OTI9C2 (formerly 9C2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
PHGDH mouse monoclonal antibody, clone OTI9C2 (formerly 9C2), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PHGDH mouse monoclonal antibody, clone OTI9C2 (formerly 9C2), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PHGDH mouse monoclonal antibody, clone OTI9C2 (formerly 9C2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of PHGDH (NM_006623) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PHGDH (NM_006623) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PHGDH (NM_006623) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack