Products

View as table Download

PHGDH (Myc-DDK-tagged)-Human phosphoglycerate dehydrogenase (PHGDH)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, PHGDH (Myc-DDK tagged) - Human phosphoglycerate dehydrogenase (PHGDH), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, PHGDH (mGFP-tagged) - Human phosphoglycerate dehydrogenase (PHGDH), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

PHGDH (GFP-tagged) - Human phosphoglycerate dehydrogenase (PHGDH)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human phosphoglycerate dehydrogenase (PHGDH), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PHGDH (Myc-DDK tagged) - Human phosphoglycerate dehydrogenase (PHGDH), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PHGDH (mGFP-tagged) - Human phosphoglycerate dehydrogenase (PHGDH), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PHGDH (untagged)-Human phosphoglycerate dehydrogenase (PHGDH)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Lenti ORF clone of Human phosphoglycerate dehydrogenase (PHGDH), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human phosphoglycerate dehydrogenase (PHGDH), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human phosphoglycerate dehydrogenase (PHGDH), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PHGDH (untagged)-Human phosphoglycerate dehydrogenase (PHGDH)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

PHGDH mouse monoclonal antibody, clone 4A3-1D6, Purified

Applications ELISA, IF, IHC, IP, WB
Reactivities Human

Recombinant protein of human phosphoglycerate dehydrogenase (PHGDH), full length, with C-terminal DDK tag, expressed in sf9, 20ug

Tag C-DDK
Expression Host Sf9

PHGDH HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Recombinant protein of human phosphoglycerate dehydrogenase (PHGDH), full length, with N-terminal HIS tag, expressed in sf9, 20ug

Tag N-His
Expression Host Sf9

PHGDH (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human PHGDH

Rabbit Polyclonal Anti-PHGDH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHGDH antibody: synthetic peptide directed towards the middle region of human PHGDH. Synthetic peptide located within the following region: CAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQF

Rabbit Polyclonal Anti-PHGDH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHGDH antibody: synthetic peptide directed towards the middle region of human PHGDH. Synthetic peptide located within the following region: SLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPA

Carrier-free (BSA/glycerol-free) PHGDH mouse monoclonal antibody, clone OTI5C4 (formerly 5C4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PHGDH mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PHGDH mouse monoclonal antibody, clone OTI9C2 (formerly 9C2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PHGDH MS Standard C13 and N15-labeled recombinant protein (NP_006614)

Tag C-Myc/DDK
Expression Host HEK293

Rabbit Polyclonal Anti-PHGDH Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PHGDH

PHGDH mouse monoclonal antibody, clone OTI5C4 (formerly 5C4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

PHGDH mouse monoclonal antibody, clone OTI5C4 (formerly 5C4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PHGDH mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

PHGDH mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PHGDH mouse monoclonal antibody, clone OTI9C2 (formerly 9C2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

PHGDH mouse monoclonal antibody, clone OTI9C2 (formerly 9C2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Transient overexpression of PHGDH (NM_006623) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of PHGDH (NM_006623) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of PHGDH (NM_006623) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack