Products

cDNA Clones (17)
Proteins (11)
Antibodies (2)
Jump to Filters
View as table Download
Phosphoserine Aminotransferase (PSAT1) (NM_058179) Human Tagged ORF Clone Lentiviral Particle
RC202475L1V

USD 1,020.00

3 Weeks

Lenti ORF particles, PSAT1 (Myc-DDK tagged) - Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Phosphoserine Aminotransferase (PSAT1) (NM_058179) Human Tagged ORF Clone Lentiviral Particle
RC202475L2V

USD 1,020.00

6 Weeks

Lenti ORF particles, PSAT1 (mGFP-tagged) - Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Phosphoserine Aminotransferase (PSAT1) (NM_058179) Human Tagged ORF Clone Lentiviral Particle
RC202475L3V

USD 1,020.00

6 Weeks

Lenti ORF particles, PSAT1 (Myc-DDK tagged) - Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Phosphoserine Aminotransferase (PSAT1) (NM_058179) Human Tagged ORF Clone Lentiviral Particle
RC202475L4V

USD 1,020.00

3 Weeks

Lenti ORF particles, PSAT1 (mGFP-tagged) - Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Phosphoserine Aminotransferase (PSAT1) (NM_021154) Human Tagged ORF Clone Lentiviral Particle
RC224645L3V

USD 820.00

11 Weeks

Lenti ORF particles, PSAT1 (Myc-DDK-tagged)-Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Phosphoserine Aminotransferase (PSAT1) (NM_021154) Human Tagged ORF Clone Lentiviral Particle
RC224645L4V

USD 820.00

11 Weeks

Lenti ORF particles, PSAT1 (mGFP-tagged)-Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Phosphoserine Aminotransferase (PSAT1) Rabbit Polyclonal Antibody
TA307984

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to PSAT1 (phosphoserine aminotransferase 1)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 48 and 328 of PSAT1 (Uniprot ID#Q9Y617)
Phosphoserine Aminotransferase (PSAT1) (NM_058179) Human Over-expression Lysate
LY409248

USD 396.00

In Stock

Transient overexpression lysate of phosphoserine aminotransferase 1 (PSAT1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Phosphoserine Aminotransferase (PSAT1) Rabbit Polyclonal Antibody
TA339354

USD 375.00

5 Days

Rabbit Polyclonal Anti-PSAT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSAT1 antibody: synthetic peptide directed towards the N terminal of human PSAT1. Synthetic peptide located within the following region: ADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASY
PSAT1 (1-370, His-tag) Human Protein
AR50153PU-N

USD 845.00

2 Weeks

PSAT1 (1-370, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
PSAT1 (1-370, His-tag) Human Protein
AR50153PU-S

USD 330.00

2 Weeks

PSAT1 (1-370, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Phosphoserine Aminotransferase (PSAT1) (NM_058179) ICC Control Block
TB402475

USD 1,070.00

4 Weeks

Transient overexpression of PSAT1 (NM_058179) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Phosphoserine Aminotransferase (PSAT1) (NM_021154) ICC Control Block
TB424645

USD 1,070.00

4 Weeks

Transient overexpression of PSAT1 (NM_021154) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Phosphoserine Aminotransferase (PSAT1) Cytosection
TS402475

USD 225.00

4 Weeks

Transient overexpression of PSAT1 (NM_058179) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Phosphoserine Aminotransferase (PSAT1) Cytosection
TS402475P5

USD 889.00

4 Weeks

Transient overexpression of PSAT1 (NM_058179) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Phosphoserine Aminotransferase (PSAT1) ICC Control Sections
TS424645P5

USD 889.00

4 Weeks

Transient overexpression of PSAT1 (NM_021154) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack