USD 477.00
In Stock
PSAT1 (Myc-DDK-tagged)-Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 477.00
In Stock
PSAT1 (Myc-DDK-tagged)-Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,020.00
3 Weeks
Lenti ORF particles, PSAT1 (Myc-DDK tagged) - Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
USD 1,020.00
6 Weeks
Lenti ORF particles, PSAT1 (mGFP-tagged) - Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 1,020.00
6 Weeks
Lenti ORF particles, PSAT1 (Myc-DDK tagged) - Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,020.00
3 Weeks
Lenti ORF particles, PSAT1 (mGFP-tagged) - Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 823.00
In Stock
Recombinant protein of human phosphoserine aminotransferase 1 (PSAT1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
USD 460.00
In Stock
PSAT1 (GFP-tagged) - Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 420.00
3 Weeks
PSAT1 (Myc-DDK-tagged)-Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 620.00
8 Weeks
Lenti-ORF clone of PSAT1 (Myc-DDK-tagged)-Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
11 Weeks
Lenti ORF particles, PSAT1 (Myc-DDK-tagged)-Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 620.00
8 Weeks
Lenti-ORF clone of PSAT1 (mGFP-tagged)-Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
11 Weeks
Lenti ORF particles, PSAT1 (mGFP-tagged)-Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 460.00
3 Weeks
PSAT1 (GFP-tagged) - Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal antibody to PSAT1 (phosphoserine aminotransferase 1)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 48 and 328 of PSAT1 (Uniprot ID#Q9Y617) |
USD 310.00
In Stock
PSAT1 (untagged)-Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 310.00
In Stock
PSAT1 (untagged)-Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
USD 396.00
In Stock
Transient overexpression lysate of phosphoserine aminotransferase 1 (PSAT1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
USD 768.00
3 Weeks
Lenti ORF clone of Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 768.00
3 Weeks
Lenti ORF clone of Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-PSAT1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSAT1 antibody: synthetic peptide directed towards the N terminal of human PSAT1. Synthetic peptide located within the following region: ADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASY |
USD 121.00
In Stock
PSAT1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 660.00
In Stock
PSAT1 (untagged)-Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PSAT1 (1-370, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
PSAT1 (1-370, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
USD 2,055.00
3 Weeks
PSAT1 MS Standard C13 and N15-labeled recombinant protein (NP_478059)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of PSAT1 (NM_058179) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PSAT1 (NM_021154) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PSAT1 (NM_058179) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PSAT1 (NM_058179) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PSAT1 (NM_021154) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack