Rabbit Polyclonal Anti-Keratin 16 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Keratin 16 Antibody: A synthesized peptide derived from human Keratin 16 |
Rabbit Polyclonal Anti-Keratin 16 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Keratin 16 Antibody: A synthesized peptide derived from human Keratin 16 |
Rabbit polyclonal Keratin 16 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Keratin 16. |
Rabbit Polyclonal Anti-KRT16 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KRT16 antibody: synthetic peptide directed towards the middle region of human KRT16. Synthetic peptide located within the following region: IAATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLD |
Rabbit Polyclonal Anti-KRT16 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KRT16 antibody: synthetic peptide directed towards the middle region of human KRT16. Synthetic peptide located within the following region: LRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKN |
Rabbit Polyclonal Anti-Keratin 16 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Keratin 16 Antibody: A synthesized peptide derived from human Keratin 16 |
Mouse monoclonal Anti-Keratin16 Clone LL025
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRT16 mouse monoclonal antibody, clone OTI2E6 (formerly 2E6)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRT16 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRT16 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRT16 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRT16 mouse monoclonal antibody, clone OTI2H8 (formerly 2H8)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRT16 mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRT16 mouse monoclonal antibody,clone OTI2F3
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRT16 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRT16 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Anti-KRT16 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 195-212 amino acids of Human Keratin, type I cytoskeletal 16 |
Anti-KRT16 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 195-212 amino acids of Human Keratin, type I cytoskeletal 16 |
Cytokeratin 16 (KRT16) Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 190-430 of human Cytokeratin 16 (KRT16) (NP_005548.2). |
Modifications | Unmodified |
KRT16 mouse monoclonal antibody, clone OTI2E6 (formerly 2E6)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
KRT16 mouse monoclonal antibody, clone OTI2E6 (formerly 2E6), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
KRT16 mouse monoclonal antibody, clone OTI2E6 (formerly 2E6), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
KRT16 mouse monoclonal antibody, clone OTI2E6 (formerly 2E6)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
KRT16 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
KRT16 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), Biotinylated
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
KRT16 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), HRP conjugated
Applications | WB |
Reactivities | Human, Rat |
Conjugation | HRP |
KRT16 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
KRT16 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
KRT16 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
KRT16 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
KRT16 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
KRT16 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
KRT16 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
KRT16 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
KRT16 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
KRT16 mouse monoclonal antibody, clone OTI2H8 (formerly 2H8)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
KRT16 mouse monoclonal antibody, clone OTI2H8 (formerly 2H8), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
KRT16 mouse monoclonal antibody, clone OTI2H8 (formerly 2H8), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
KRT16 mouse monoclonal antibody, clone OTI2H8 (formerly 2H8)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
KRT16 mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
KRT16 mouse monoclonal antibody, clone OTI7A4 (formerly 7A4), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
KRT16 mouse monoclonal antibody, clone OTI7A4 (formerly 7A4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
KRT16 mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
KRT16 mouse monoclonal antibody,clone OTI2F3
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
KRT16 mouse monoclonal antibody,clone OTI2F3, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
KRT16 mouse monoclonal antibody,clone OTI2F3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
KRT16 mouse monoclonal antibody,clone OTI2F3
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
KRT16 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
KRT16 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), Biotinylated
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
KRT16 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), HRP conjugated
Applications | WB |
Reactivities | Human, Rat |
Conjugation | HRP |
KRT16 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |