Germany
Japan
United Kingdom
China
Rabbit polyclonal Fra-1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Fra-1. |
Products
View as table Download
Rabbit Polyclonal anti-FOSL1 antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOSL1 antibody: synthetic peptide directed towards the middle region of human FOSL1. Synthetic peptide located within the following region: TDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAK |
Goat Polyclonal Antibody against FRA1 / FOSL1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QREIEELQKQKER, from the internal region of the protein sequence according to NP_005429.1. |
Rabbit Polyclonal anti-FOSL1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOSL1 antibody: synthetic peptide directed towards the middle region of human FOSL1. Synthetic peptide located within the following region: EKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSP |
FOSL1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FOSL1 |
FOSL1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FOSL1 (NP_005429.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- FOSL1
Reactivities
- Human