Germany
Japan
United Kingdom
China
FOSL1 (Myc-DDK-tagged)-Human FOS-like antigen 1 (FOSL1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table Download
FOSL1 (GFP-tagged) - Human FOS-like antigen 1 (FOSL1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, FOSL1 (Myc-DDK-tagged)-Human FOS-like antigen 1 (FOSL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, FOSL1 (mGFP-tagged)-Human FOS-like antigen 1 (FOSL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Fosl1 (Myc-DDK-tagged) - Mouse fos-like antigen 1 (Fosl1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Fosl1 (GFP-tagged) - Mouse fos-like antigen 1 (Fosl1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human FOS-like antigen 1 (FOSL1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
FOSL1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN402104 is the updated version of KN202104.
Fosl1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN506063 is the updated version of KN306063.
Lenti ORF clone of Fosl1 (Myc-DDK-tagged) - Mouse fos-like antigen 1 (Fosl1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fosl1 (Myc-DDK-tagged) - Mouse fos-like antigen 1 (Fosl1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, Fosl1 (GFP-tagged) - Mouse fos-like antigen 1 (Fosl1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of FOSL1 (Myc-DDK-tagged)-Human FOS-like antigen 1 (FOSL1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, FOSL1 (Myc-DDK-tagged)-Human FOS-like antigen 1 (FOSL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, FOSL1 (mGFP-tagged)-Human FOS-like antigen 1 (FOSL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
FOSL1 (myc-DDK-tagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
FOSL1 (myc-DDK-tagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
FOSL1 (myc-DDK-tagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
FOSL1 (myc-DDK-tagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Fosl1 (Myc-DDK-tagged ORF) - Rat fos-like antigen 1 (Fosl1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Fosl1 (Myc-DDK-tagged ORF) - Rat fos-like antigen 1 (Fosl1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fosl1 (Myc-DDK-tagged ORF) - Rat fos-like antigen 1 (Fosl1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Fosl1 (mGFP-tagged ORF) - Rat fos-like antigen 1 (Fosl1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fosl1 (GFP-tagged ORF) - Rat fos-like antigen 1 (Fosl1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
FOSL1 (untagged)-Human FOS-like antigen 1 (FOSL1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Fosl1 (mGFP-tagged) - Mouse fos-like antigen 1 (Fosl1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti-ORF clone of FOSL1 (Myc-DDK-tagged)-Human FOS-like antigen 1 (FOSL1)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
qSTAR qPCR primer pairs against Homo sapiens gene FOSL1
FOSL1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Fosl1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Rabbit polyclonal Fra-1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Fra-1. |
Fosl1 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Rabbit Polyclonal anti-FOSL1 antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOSL1 antibody: synthetic peptide directed towards the middle region of human FOSL1. Synthetic peptide located within the following region: TDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAK |
FOSL1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
qSTAR qPCR primer pairs against Mus musculus gene Fosl1
Goat Polyclonal Antibody against FRA1 / FOSL1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QREIEELQKQKER, from the internal region of the protein sequence according to NP_005429.1. |
Rabbit Polyclonal anti-FOSL1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOSL1 antibody: synthetic peptide directed towards the middle region of human FOSL1. Synthetic peptide located within the following region: EKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSP |
FOSL1 CRISPRa kit - CRISPR gene activation of human FOS like 1, AP-1 transcription factor subunit
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene FOSL1
| Application | Plasmid of exact quantity for transcript copy number calculation |
Fosl1 (untagged) - Mouse fos-like antigen 1 (Fosl1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
FOSL1 MS Standard C13 and N15-labeled recombinant protein (NP_005429)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
FOSL1 (GFP-tagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
FOSL1 (GFP-tagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
FOSL1 (GFP-tagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
FOSL1 (GFP-tagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Fosl1 (untagged ORF) - Rat fos-like antigen 1 (Fosl1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
FOSL1 (untagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
FOSL1 (untagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
FOSL1 (untagged) - Human FOS-like antigen 1 (FOSL1), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Active filters
Target Symbol
- FOSL1