Products

View as table Download

Rabbit Polyclonal IL-9 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-9 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human IL-9.

Anti-Human IL-9 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-9

Rabbit polyclonal anti-IL-9 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-9 protein.

Rabbit polyclonal IL-9 antibody Peroxidase Conjugated

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-9 protein.

Biotinylated Anti-Human IL-9 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-9

Rabbit Polyclonal Anti-IL9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL9 Antibody: synthetic peptide directed towards the middle region of human IL9. Synthetic peptide located within the following region: SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALT

IL9 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL9

Recombinant Anti-IL-9 (Clone MH9A4)

Applications ELISA, FC
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-IL-9 (Clone MH9A4)

Applications ELISA, FC
Reactivities Human
Conjugation Unconjugated