Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit polyclonal anti-IL-9 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-9 protein. |
Rabbit polyclonal IL-9 antibody Peroxidase Conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-9 protein. |
Rabbit Polyclonal Anti-IL9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL9 Antibody: synthetic peptide directed towards the middle region of human IL9. Synthetic peptide located within the following region: SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALT |
IL9 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IL9 |
Recombinant Anti-IL-9 (Clone MH9A4)
| Applications | ELISA, FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-IL-9 (Clone MH9A4)
| Applications | ELISA, FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- IL9
Reactivities
- Human