Products

Jump to Filters
View as table Download
PSMA1 Rabbit Polyclonal Antibody
TA345809

USD 475.00

5 Days

Rabbit Polyclonal Anti-PSMA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMA1 antibody: synthetic peptide directed towards the C terminal of human PSMA1. Synthetic peptide located within the following region: TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDL
PSMA1 Rabbit Polyclonal Antibody
TA332538

USD 275.00

3 Weeks

Rabbit anti-PSMA1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PSMA1
PSMA1 Rabbit Polyclonal Antibody
TA345810

USD 410.00

5 Days

Rabbit Polyclonal Anti-PSMA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMA1 antibody: synthetic peptide directed towards the N terminal of human PSMA1. Synthetic peptide located within the following region: MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALK
PSMA1 Mouse Monoclonal Antibody [Clone ID: OTI9H1]
CF812757

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PSMA1 mouse monoclonal antibody,clone OTI9H1

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PSMA1 Mouse Monoclonal Antibody [Clone ID: OTI6C4]
CF812761

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PSMA1 mouse monoclonal antibody,clone OTI6C4

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PSMA1 Rabbit Polyclonal Antibody
TA365995

USD 380.00

4 Weeks

PSMA1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PSMA1
PSMA1 Rabbit Polyclonal Antibody
TA370346

USD 380.00

4 Weeks

PSMA1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PSMA1
PSMA1 Mouse Monoclonal Antibody [Clone ID: OTI9H1]
TA812757

USD 379.00

In Stock

PSMA1 mouse monoclonal antibody,clone OTI9H1

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PSMA1 Mouse Monoclonal Antibody [Clone ID: OTI9H1]
TA812757S

USD 159.00

2 Days

PSMA1 mouse monoclonal antibody,clone OTI9H1

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PSMA1 Mouse Monoclonal Antibody [Clone ID: OTI6C4]
TA812761

USD 379.00

In Stock

PSMA1 mouse monoclonal antibody,clone OTI6C4

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PSMA1 Mouse Monoclonal Antibody [Clone ID: OTI6C4]
TA812761S

USD 159.00

2 Days

PSMA1 mouse monoclonal antibody,clone OTI6C4

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated