Products

View as table Download

Rabbit Polyclonal SEMA3B Antibody

Applications WB
Reactivities Bovine, Canine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human SEMA 3B protein sequence (between residues 100-200).

Rabbit Polyclonal Anti-SEMA3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SEMA3B antibody is: synthetic peptide directed towards the middle region of Human SEMA3B. Synthetic peptide located within the following region: FRSLGQRPSLRTEPHDSRWLNEPKFVKVFWIPESENPDDDKIYFFFRETA

SEMA3B Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 569-748 of human SEMA3B (NP_001005914.1).
Modifications Unmodified