Products

cDNA Clones (49)
Proteins (19)
RNAi (11)
Gene Expression (8)
Antibodies (3)
Jump to Filters
View as table Download
Semaphorin 3B (SEMA3B) (NM_004636) Human Tagged ORF Clone
RC223532

USD 420.00

In Stock

SEMA3B (Myc-DDK-tagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Semaphorin 3B (SEMA3B) (NM_001005914) Human Tagged ORF Clone
RC202875

USD 420.00

In Stock

SEMA3B (Myc-DDK-tagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Sema3b (NM_009153) Mouse Tagged ORF Clone
MR222703

USD 790.00

In Stock

Sema3b (Myc-DDK-tagged) - Mouse sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (Sema3b), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Sema3b (NM_001042779) Mouse Tagged ORF Clone
MR231054

USD 790.00

In Stock

Sema3b (myc-DDK-tagged) - Mouse sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (Sema3b), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Sema3b (NM_001291537) Mouse Tagged ORF Clone
MR231055

USD 790.00

In Stock

Sema3b (myc-DDK-tagged) - Mouse sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (Sema3b), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Sema3b (NM_001291538) Mouse Tagged ORF Clone
MR231056

USD 790.00

In Stock

Sema3b (myc-DDK-tagged) - Mouse sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (Sema3b), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Sema3b (NM_001291539) Mouse Tagged ORF Clone
MR231057

USD 790.00

In Stock

Sema3b (myc-DDK-tagged) - Mouse sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (Sema3b), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Semaphorin 3B (SEMA3B) (NM_001290060) Human Tagged ORF Clone
RC239473

USD 420.00

In Stock

SEMA3B (myc-DDK-tagged) - Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Semaphorin 3B (SEMA3B) (NM_004636) Human Tagged ORF Clone
RG223532

USD 460.00

In Stock

SEMA3B (GFP-tagged) - Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Semaphorin 3B (SEMA3B) Human Gene Knockout Kit (CRISPR)
KN402875

USD 1,290.00

2 Weeks

SEMA3B - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN402875 is the updated version of KN202875.
Sema3b Mouse Gene Knockout Kit (CRISPR)
KN515494

USD 1,290.00

2 Weeks

Sema3b - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN515494 is the updated version of KN315494.
Sema3b (NM_009153) Mouse Tagged ORF Clone
MG222703

USD 870.00

3 Weeks

Sema3b (GFP-tagged) - Mouse sema domain immunoglobulin domain (Ig) short basic domain secreted (semaphorin) 3B (Sema3b) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Sema3b (NM_009153) Mouse Tagged ORF Clone
MR222703L3

USD 990.00

3 Weeks

Lenti ORF clone of Sema3b (Myc-DDK-tagged) - Mouse sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (Sema3b), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Sema3b (NM_009153) Mouse Tagged ORF Clone Lentiviral Particle
MR222703L3V

USD 1,190.00

6 Weeks

Lenti ORF particles, Sema3b (Myc-DDK-tagged) - Mouse sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (Sema3b), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Sema3b (NM_009153) Mouse Tagged ORF Clone
MR222703L4

USD 990.00

3 Weeks

Lenti ORF clone of Sema3b (mGFP-tagged) - Mouse sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (Sema3b), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Sema3b (NM_009153) Mouse Tagged ORF Clone Lentiviral Particle
MR222703L4V

USD 1,190.00

6 Weeks

Lenti ORF particles, Sema3b (GFP-tagged) - Mouse sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (Sema3b), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 3B (SEMA3B) (NM_001005914) Human Tagged ORF Clone
RC202875L3

USD 620.00

3 Weeks

Lenti-ORF clone of SEMA3B (Myc-DDK-tagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 3B (SEMA3B) (NM_001005914) Human Tagged ORF Clone Lentiviral Particle
RC202875L3V

USD 820.00

6 Weeks

Lenti ORF particles, SEMA3B (Myc-DDK-tagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 3B (SEMA3B) (NM_001005914) Human Tagged ORF Clone
RC202875L4

USD 620.00

3 Weeks

Lenti-ORF clone of SEMA3B (mGFP-tagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 3B (SEMA3B) (NM_001005914) Human Tagged ORF Clone Lentiviral Particle
RC202875L4V

USD 820.00

6 Weeks

Lenti ORF particles, SEMA3B (mGFP-tagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 3B (SEMA3B) (NM_004636) Human Tagged ORF Clone
RC223532L3

USD 620.00

3 Weeks

Lenti-ORF clone of SEMA3B (Myc-DDK-tagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 3B (SEMA3B) (NM_004636) Human Tagged ORF Clone Lentiviral Particle
RC223532L3V

USD 820.00

6 Weeks

Lenti ORF particles, SEMA3B (Myc-DDK-tagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 3B (SEMA3B) (NM_004636) Human Tagged ORF Clone
RC223532L4

USD 620.00

3 Weeks

Lenti-ORF clone of SEMA3B (mGFP-tagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 3B (SEMA3B) (NM_004636) Human Tagged ORF Clone Lentiviral Particle
RC223532L4V

USD 820.00

6 Weeks

Lenti ORF particles, SEMA3B (mGFP-tagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 3B (SEMA3B) (NM_001290062) Human Tagged ORF Clone
RC238019

USD 430.00

2 Weeks

SEMA3B (myc-DDK-tagged) - Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Semaphorin 3B (SEMA3B) (NM_001290063) Human Tagged ORF Clone
RC238020

USD 430.00

2 Weeks

SEMA3B (myc-DDK-tagged) - Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Semaphorin 3B (SEMA3B) (NM_001290061) Human Tagged ORF Clone
RC239487

USD 610.00

3 Weeks

SEMA3B (myc-DDK-tagged) - Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Semaphorin 3B (SEMA3B) (NM_001005914) Human Tagged ORF Clone
RG202875

USD 460.00

3 Weeks

SEMA3B (GFP-tagged) - Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Sema3b (NM_001079942) Rat Tagged ORF Clone
RR213455

USD 1,020.00

5 Weeks

Sema3b (Myc-DDK-tagged ORF) - Rat sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (Sema3b), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Sema3b (NM_001079942) Rat Tagged ORF Clone
RR213455L3

USD 1,210.00

11 Weeks

Lenti ORF clone of Sema3b (Myc-DDK-tagged ORF) - Rat sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (Sema3b), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Sema3b (NM_001079942) Rat Tagged ORF Clone Lentiviral Particle
RR213455L3V

USD 1,420.00

15 Weeks

Lenti ORF particles, Sema3b (Myc-DDK-tagged ORF) - Rat sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (Sema3b), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Sema3b (NM_001079942) Rat Tagged ORF Clone
RR213455L4

USD 1,320.00

11 Weeks

Lenti ORF clone of Sema3b (mGFP-tagged ORF) - Rat sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (Sema3b), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Sema3b (NM_001079942) Rat Tagged ORF Clone Lentiviral Particle
RR213455L4V

USD 1,590.00

15 Weeks

Lenti ORF particles, Sema3b (GFP-tagged ORF) - Rat sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (Sema3b), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 3B (SEMA3B) (NM_004636) Human Untagged Clone
SC117239

USD 310.00

In Stock

SEMA3B (untagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Semaphorin 3B (SEMA3B) (NM_004636) Human Over-expression Lysate
LY417853

USD 396.00

5 Days

Transient overexpression lysate of sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Sema3b (NM_009153) Mouse Untagged Clone
MC221293

USD 1,020.00

In Stock

Sema3b (untagged) - Mouse sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (Sema3b), transcript variant 2, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Semaphorin 3B (SEMA3B) (NM_004636) Human Over-expression Lysate
LC417853

USD 121.00

In Stock

SEMA3B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Semaphorin 3B (SEMA3B) (NM_001005914) Human Untagged Clone
SC319265

USD 760.00

In Stock

SEMA3B (untagged)-Human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Semaphorin 3B (SEMA3B) (NM_001005914) Human Over-expression Lysate
LY423670

USD 396.00

5 Days

Transient overexpression lysate of sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (SEMA3B), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Semaphorin 3B (SEMA3B) Rabbit Polyclonal Antibody
TA309848

USD 457.00

5 Days

Rabbit Polyclonal SEMA3B Antibody

Applications WB
Reactivities Bovine, Canine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human SEMA 3B protein sequence (between residues 100-200).
Semaphorin 3B (SEMA3B) Rabbit Polyclonal Antibody
TA330905

USD 375.00

5 Days

Rabbit Polyclonal Anti-SEMA3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SEMA3B antibody is: synthetic peptide directed towards the middle region of Human SEMA3B. Synthetic peptide located within the following region: FRSLGQRPSLRTEPHDSRWLNEPKFVKVFWIPESENPDDDKIYFFFRETA
Human Semaphorin 3B (SEMA3B) activation kit by CRISPRa
GA105343

USD 1,290.00

2 Weeks

SEMA3B CRISPRa kit - CRISPR gene activation of human semaphorin 3B

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Sema3b activation kit by CRISPRa
GA203832

USD 1,290.00

2 Weeks

Sema3b CRISPRa kit - CRISPR gene activation of mouse sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
SEMA3B Human qPCR Template Standard (NM_004636)
HK206606

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene SEMA3B

Application Plasmid of exact quantity for transcript copy number calculation
Semaphorin 3B (SEMA3B) Human qPCR Template Standard (NM_001005914)
HK208540

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene SEMA3B

Application Plasmid of exact quantity for transcript copy number calculation
Semaphorin 3B (SEMA3B) (NM_001005914) Human Over-expression Lysate
LC423670

USD 121.00

2 Weeks

SEMA3B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Sema3b (NM_001042779) Mouse Untagged Clone
MC228843

USD 760.00

3 Weeks

Sema3b (untagged) - Mouse sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (Sema3b), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Sema3b (NM_001291537) Mouse Untagged Clone
MC228844

USD 760.00

3 Weeks

Sema3b (untagged) - Mouse sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (Sema3b), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Sema3b (NM_001291538) Mouse Untagged Clone
MC228845

USD 760.00

3 Weeks

Sema3b (untagged) - Mouse sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B (Sema3b), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin