Products

View as table Download

Rabbit polyclonal antibody to TRPM2 (transient receptor potential cation channel, subfamily M, member 2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 181 and 423 of TRPM2 (Uniprot ID#O94759)

Rabbit Polyclonal Anti-TRPM2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPM2 antibody: synthetic peptide directed towards the N terminal of human TRPM2. Synthetic peptide located within the following region: VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK

Rabbit Polyclonal Anti-TRPM2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)HTFQGKEWDPKKHVQE, corresponding to amino acid residues 105-120 of mouse TRPM2. Intracellular, N-terminus.

Rabbit Polyclonal Anti-TRPM2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TRPM2

TRPM2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TRPM2